KEGG   Bacillus intestinalis: BIS30_12225Help
Entry
BIS30_12225       CDS       T05513                                 

Definition
(GenBank) flavoprotein
Organism
bit  Bacillus intestinalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: K_oxygenase NAD_binding_9 Pyr_redox_3 Pyr_redox_2 DAO NAD_binding_8 ApbA Pyr_redox NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AJW85854
LinkDB All DBs
Position
2323437..2324609
Genome map
AA seq 390 aa AA seqDB search
MYKWLIIGGGIQGSTLAVHLVKSRRASIEDIAVIDPHERPLECWKRNTSRIQMKYLRSPS
VHHVDTEPFSLQTHADKSQWPEVFFGRYKRPSLSFFNQHCETVLDEIHMDQAWKTGMVTN
LRRANGLWEAETDTAGTLRGERVVLAMSFSHQPSWPEWAKPFQNSGIYHVFDREVHDVSN
ESLQMAVVGGGITAAHYAIKLADDGHDVTMLVRHPFRIYDFDSDPGWLGPKYMKAFSKTS
DYQKRRQWITSARHRGSFPKDISRTLAVYKEEGRVKVIQDEIDFCQKTDDGKIQIHCKTS
ESRYEYERVALATGFTSDISRFDWVQRAAQAEQLPYAGCGFPIIGKDLQWGKGLYVMGAF
AELEIGPTARNISGARKAAYTIAYTAKHTS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtataaatggctgatcattggcggcggcatccaaggctcaaccttggctgtgcatctt
gtgaaaagcagaagggcatcgattgaggatattgctgtcattgatccccatgaacgccct
cttgaatgctggaaacgaaacacaagccgcattcagatgaaatacttgcgctctccatcg
gttcatcatgtagacacagagccgttcagcctgcaaacgcatgcggataaaagccaatgg
ccggaagtattctttggaagatataagaggccctcgctttcgttcttcaatcagcactgc
gagactgtgctagatgaaatacatatggatcaagcatggaaaacaggcatggtgacaaat
ttgagaagggcaaacgggttgtgggaagcggagacagataccgctggtactctcaggggg
gaacgagtcgttttagccatgagtttttctcatcagccttcttggccggagtgggcaaaa
ccatttcagaatagcggcatttatcatgtgtttgacagagaggtgcacgatgtaagcaat
gaaagtctgcaaatggcagttgtgggcggggggataacggctgctcattacgccataaaa
ctcgcagatgacggccatgatgtaacgatgctggtgaggcatccgttccggatctatgac
ttcgatagtgatccaggatggcttggtccgaaatatatgaaagcattcagtaaaacgtct
gactatcaaaagagaaggcaatggattacaagcgccagacatcgcggctcttttccaaag
gacatttcaagaacacttgctgtctataaggaggagggcagagtaaaagtcattcaggat
gaaattgatttttgtcaaaaaacagatgacggcaagatacagatacactgtaaaacgagt
gaatcacgatacgaatacgagcgtgtcgcattggcaacaggttttacctcggacatcagc
cggttcgattgggtacagagagcagcgcaagcggagcaattgccttatgcaggctgcggt
tttccgattattggcaaggatttgcaatggggaaaaggcttatatgtgatgggagccttt
gctgaattagaaatcgggccgacagcgagaaatatttccggagcacgaaaagctgcttac
accattgcttatacggcgaagcatacaagttaa

DBGET integrated database retrieval system