KEGG   Bacillus intestinalis: BIS30_12240Help
Entry
BIS30_12240       CDS       T05513                                 

Definition
(GenBank) amino acid ABC transporter substrate-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
bit  Bacillus intestinalis
Pathway
bit02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bit00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BIS30_12240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bit02000]
    BIS30_12240
   02035 Bacterial motility proteins [BR:bit02035]
    BIS30_12240
Transporters [BR:bit02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    BIS30_12240
Bacterial motility proteins [BR:bit02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    BIS30_12240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AJW87516
LinkDB All DBs
Position
complement(2326578..2327429)
Genome map
AA seq 283 aa AA seqDB search
MPSKAVIFSFTMAFFLILAACSGKNEADSKDTGWEQIKDKGKIVVATSGTLYPTSYHDTD
SGSDKLTGYEVEVVREAAKRLGLKVEFKEMGIDGMLTAVNSGQVDAAANDIDVTKDREKK
FAFSTPYKYSYGTAIVRKDDLSGIKTLKDLKGKKAAGAATTVYMDVARKYGAQEVIYDNA
TNEQYLKDVANGRTDVILNDYYLQTLALAAFPDLNITIHPDIKYMPNKQALVMKKSNAAL
QKKMNETLKEMSKDGTLTKLSKQFFNKADVSKKLDVDVQDVGL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgccatcgaaagccgttatattcagtttcacaatggctttctttcttatattggcagcc
tgttccggcaaaaatgaagccgattccaaggatacaggctgggagcagatcaaagacaaa
gggaaaattgttgtcgctacatctggcacgctttatcccacttcttatcacgataccgat
tcaggttccgataagctgacgggctatgaggttgaagtcgttcgtgaagcggcaaaacgc
ttgggcctgaaggttgagttcaaggagatgggcattgacggaatgctgacagcggtgaac
agcggccaggttgacgcagccgcaaatgacatcgatgtgacgaaggaccgcgagaagaag
ttcgcgttctccactccatataaatattcatacggcacggcaatcgtccgaaaagacgat
ttatcagggattaaaacgcttaaggatttaaaaggaaagaaagccgctggcgcagctacg
acagtctacatggatgtagcgagaaaatacggcgctcaagaagtgatttatgataatgcg
accaatgagcagtatttaaaagatgtcgctaacggacgcactgatgtcattttaaacgac
tattacctgcagacacttgcgctcgcagcattcccggatctcaacattacgatccatcct
gacatcaagtacatgccgaacaaacaagcgcttgtcatgaaaaaaagcaatgcagcactt
cagaaaaagatgaacgaaacattgaaggaaatgagcaaggatggcactttgacaaagtta
tcgaaacaattcttcaataaagcagatgtatcaaagaaactggatgtcgacgttcaagac
gttggtttgtaa

DBGET integrated database retrieval system