KEGG   Bacillus intestinalis: BIS30_14295Help
Entry
BIS30_14295       CDS       T05513                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bit  Bacillus intestinalis
Pathway
bit00627  Aminobenzoate degradation
bit01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BIS30_14295
Enzymes [BR:bit01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BIS30_14295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJW86223
LinkDB All DBs
Position
2750244..2751701
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGKWQEGSSPNVLENKNPYTQKTFTTFQKATADDVDEAYRAAALAKKK
WDAVNPFEKRTILEKAVTYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIMKEAATFP
VRMEGKILPSTIDGKENRLYRVPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFENAGIPEGLLNVVVTDIAEIGDSFVEHPVPRIISFTGSTKVGSYIG
QLAMKHFKKPLLELGGNSAFIVLEDADIEYAVNAAVFSRFTHQGQICMSANRVLVHSSIY
DKFLEMYQAKVESLKVGDPMDPDTIIGPLINSRQTDGLMKSVEKAIEEGAVPVKLGGFNG
TIVEPTILKDVKPFMSIAKEELFGPVVSFMKFDSEDEAVDIANETPFGLSGAVHTSNLER
GVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHQK
RSFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagagttgaataaacaatttatcggcgggaaatggcaggagggcagc
agcccaaatgtattagaaaacaaaaatccttatactcaaaaaacattcacaaccttccaa
aaagcgactgctgacgatgtagatgaagcgtaccgggcagcggcgctggcgaagaaaaaa
tgggatgcggtcaatccgtttgaaaaaagaaccattttagaaaaagccgtcacgtatatt
gaagagaacgaagaagccatcatttatttgattatggaggagcttggcggaacaaggctc
aaagcagcctttgaaatcgggcttgtcaaaaacattatgaaagaagcggcgacgttccct
gtccgcatggaaggaaaaattcttccgtcaacaatagatggcaaggaaaacagattatat
cgcgtgccggcaggcgttgtcggtgtcatcagcccatttaacttcccattctttttatct
atgaaatcagtggcgcccgcgctcggagcaggcaatggcgtcgttttaaagccgcatgaa
gaaacaccgatttgcggcggtacactgattgcgaaaatttttgagaacgcgggaatccca
gaggggctgctgaatgtcgttgtcacagacattgcagaaatcggagacagctttgtggaa
cacccggtaccgcggatcatctcatttacaggttctacgaaagtcggcagctatatcggc
cagcttgcgatgaagcattttaaaaagccgcttcttgagctcggcggaaacagcgccttt
atcgtgcttgaagatgcggatatcgaatatgcggtcaatgcggcagtgtttagcagattt
acccatcaagggcagatctgtatgtcagccaaccgcgtacttgttcactcatcaatttat
gataagttccttgaaatgtatcaggcaaaagtggaatcgctgaaggttggcgacccgatg
gaccctgacacgattatcgggccattaatcaacagcagacagacggacgggctgatgaaa
tctgttgagaaagcgattgaagaaggggctgttccagtgaagcttggcgggtttaacggg
acaattgtggaaccgacgatcttaaaagacgtgaaaccgttcatgagcattgccaaggaa
gagctattcggacctgtcgtctcctttatgaagtttgattcagaagacgaagcggttgat
atcgcaaacgaaacgccgtttggtttgagcggtgccgtacatacgtcaaatcttgaacgc
ggcgtggcttttgcgaagcgcattgaaacaggcatgattcatgtcaatgacacgacaatc
aatgatgaaccgaatgtggccttcggcggtgaaaagcaatccggtctcggccgattgaac
ggcgagtggagccttgaagaatttacgacactgaaatggatttcggtccagcaccaaaaa
cgcagcttcccttattaa

DBGET integrated database retrieval system