KEGG   Bacillus intestinalis: BIS30_15340Help
Entry
BIS30_15340       CDS       T05513                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bit  Bacillus intestinalis
Pathway
bit00564  Glycerophospholipid metabolism
bit01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BIS30_15340
Enzymes [BR:bit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BIS30_15340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA Pyr_redox_2 NAD_binding_8 FAD_oxidored 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AJW86394
LinkDB All DBs
Position
2937612..2939276
Genome map
AA seq 554 aa AA seqDB search
MKQQFSSLERDRMLTDMTKKNYDLFIIGGGITGAGTALDAASRGMKVALSEMQDFAAGTS
SRSTKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGSFTT
SIGLRVYDFLAGVKKSERRSMLSAKETLHKEPLVKKDGLKGGGYYVEYRTDDARLTIEVM
KEAVKFGAEPVNYSKVKELLYEKGKAVGVLIEDMLTKKEYKVYAKKIVNATGPWVDQLRE
KDHSKNGKHLQHTKGIHLVFDQSVFPLKQAVYFDTPDGRMVFAIPREGKTYVGTTDTVYK
EALEHPRMTTEDRDYVINSINYMFPELNITANDIESSWAGLRPLIHEEGKDPSEISRKDE
IWTSDSGLITIAGGKLTGYRKMAEHIVDLVRDRLKEEGEKDFGPCKTKNMPISGGHVGGS
KNLMSFVTTKTKEGIAAGLSEKDAKQLAIRYGSNVERVFNRVEALKDEAAKRHIPVHILA
EAEYSIEEEMTATPADFFVRRTGRLFFDINWVRTYKDAVIDFMSERFQWDEQTKNKHTEN
LNKLLHDAVVPLEQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacaattttcaagtcttgaaagagatcgcatgctgacagacatgacgaaaaaa
aactatgatctatttattatcggaggaggaattacaggagcgggaacagctcttgacgcg
gcatcaaggggaatgaaagtcgcgcttagcgaaatgcaagatttcgcggcgggaacatca
agccgatcaaccaaattggttcatggcggcttgcgttatttaaaacaatttgaagtgaaa
atggttgctgaggtagggaaagagcgggcgattgtctatgaaaacggcccgcacgtcact
acaccggaatggatgctgcttccgtttcataaaggcggcacattcggttcattcacaacc
tctatcggtttaagagtttatgacttcttagccggcgtaaaaaaatcagaacgcagaagc
atgctttcagcaaaagaaacgctgcataaagagcctttggtgaaaaaagacggcttaaaa
ggtggcggctactatgtggaataccgcactgacgatgcaagactgacaatcgaggtcatg
aaggaagcagtcaaatttggggcagagccagtgaattattccaaagtgaaggagctcctt
tatgaaaaaggcaaagcagttggcgtattaattgaagacatgctgacaaagaaagaatat
aaagtgtacgcgaaaaaaattgtcaatgcgacaggcccttgggtcgaccagctcagagaa
aaagaccattcaaaaaacggaaagcatttgcagcatacaaaaggcattcaccttgtattt
gaccagtctgtctttccgctgaaacaggcagtatatttcgatacacctgacggccgtatg
gtatttgcgattcctcgtgagggcaaaacatacgtgggaacaacagacaccgtatacaaa
gaggcgctggaacatccgcgaatgacaacggaggatcgtgattacgtcatcaattcaatc
aattacatgttcccggaactgaatatcactgcgaatgacattgaatccagttgggcgggg
ctgcgtccgctgattcatgaagaaggcaaagacccttctgaaatttcacggaaagacgag
atttggacatctgactcaggtttgatcaccatcgccggcgggaagctgacaggatacaga
aaaatggcggagcacatcgtcgatcttgtgcgtgatcgcttaaaagaagaaggcgaaaag
gatttcggtccatgtaaaacgaaaaacatgccaatctcaggagggcacgtcggaggttcg
aaaaatctcatgtccttcgttactacgaaaacaaaagaaggaatcgcagccggtttatca
gaaaaagatgcaaaacagctggcgatcagatacggctccaatgtagagcgtgtatttaat
cgggtagaagcactgaaagatgaggccgcgaaacgtcacattccggttcatattcttgct
gaggcagaatacagtatagaagaagagatgactgcaacacctgctgacttctttgtccgc
agaacgggacgtttattttttgatatcaattgggtaagaacatataaagatgccgttatt
gattttatgagcgagcgattccaatgggatgagcagacgaaaaacaaacatacagaaaac
ctcaacaagcttttacacgatgcggttgtaccgctcgaacaataa

DBGET integrated database retrieval system