KEGG   Bos indicus (zebu cattle): 109553030
Entry
109553030         CDS       T04792                                 

Gene name
NFKB2
Definition
(RefSeq) nuclear factor NF-kappa-B p100 subunit isoform X1
  KO
K04469  nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04064  NF-kappa B signaling pathway
biu04380  Osteoclast differentiation
biu04625  C-type lectin receptor signaling pathway
biu05134  Legionellosis
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109553030 (NFKB2)
   04064 NF-kappa B signaling pathway
    109553030 (NFKB2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109553030 (NFKB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109553030 (NFKB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109553030 (NFKB2)
   05203 Viral carcinogenesis
    109553030 (NFKB2)
  09162 Cancer: specific types
   05224 Breast cancer
    109553030 (NFKB2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    109553030 (NFKB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109553030 (NFKB2)
   05169 Epstein-Barr virus infection
    109553030 (NFKB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109553030 (NFKB2)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    109553030 (NFKB2)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 109553030
NCBI-ProteinID: XP_019808426
UniProt: A0A6P5B7B6
LinkDB
Position
26
AA seq 901 aa
MDSCYDPGLDGIIEYDDFKFNPSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGVC
AVSVGPKDMTAQFNNLGVLHVTKKNMMEIMIQKLQRQRLRSRPQGLTEAERRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGSAGGYGGAGGGGGSLGFFPSSLAYSPYQSGAAPMGCYPGGGGGAQMAAETPSVDAGEE
AAEPSAPPGTPQREQQTPELLHRAREYNARLFGLAQRSARALLDYGVTADARSLLAGQRH
LLTAQDENGDTPLHLAIIHGQTTVIEQIAHVIYHAPHLGVVNITNHLHQTPLHLAVITGQ
TKVVSFLLQVGADPALLDRHGDSAVHLALRAGASAPDMLCALLRSGVPAMPQLLHVPDFE
GLYPVHLAVRARSPECLDLLVESGAEVEAAERQGGRTALHLATEMEELGLVTHLVTKLRA
NVNARTFAGNTPLHLAAGLGSPTLTRLLLKAGADVHAENEEPLCPLPSPPTSGSDSDSES
PERDTRGSFRGHTPLDXTRSSKVKTLLLNAAQDTMAPPLTPPSPAGPEIPLEDTVLQNLE
HLLDGPGAQGSWVELAERLGLRSLVDTYRRTASPSGSLLRSYQLAGGDWTGLLNALSDMG
LEEGVRLLKGPETQEKLPSTAEVKEDSAYGSQSVEQETEKLGPPPEPPGGLCHGRPQPQV
H
NT seq 2706 nt   +upstreamnt  +downstreamnt
atggacagttgctacgacccaggtctggatggcatcattgaatatgatgatttcaaattc
aacccgtccattgtggagcccaaggagccagccccagagacagctgatggtccctacctg
gtgatcgtggaacagcctaagcagcgaggcttccgatttcgatatggctgtgaaggccct
tcccatggaggactgccaggagcctctagcgagaagggccggaagacttatcccactgtc
aagatctgtaactacgagggacctgccaagattgaggtggacctggtaacacacagtgac
ccgcctcgtgcccatgcccacagtctggtgggcaaacagtgctcggagctgggggtctgc
gcagtgtctgtggggcccaaggacatgactgcccaatttaacaacctgggtgtcctccat
gtgaccaaaaagaacatgatggagattatgatacaaaaacttcagaggcagcgtcttcgs
tccaggccccagggccttacggaggctgagcgtcgagagctggagcaggaggccaaggaa
ctgaagaaggtgatggatctgagcattgtgcgactgcgcttttctgccttccttcgagcc
agtgatggctccttctctctgcccctgaagccagttatctcccagcccatacatgacagc
aagtctcctggagcctcaaacctgaagatttctcgaatggacaagacagctggctctgtg
cggggtggagatgaggtttatctgctctgtgacaaggtgcagaaagatgacattgaggtt
cggttctacgaggatgatgagaatggatggcaggcctttggggacttctctcccacagat
gttcacaaacagtatgccattgtgttccggacacctccctatcacaagatgaagattgag
cgtcctgtaaccgtgttcctgcaactgaaacgcaagcgtgggggggaygtctctgactcc
aaacagttcacctattatcctctggtagaagacaaggaggaggtgcagcggaagcggagg
aaagccttgcccaccttctcccagccctttgggggtggctcccacatgggtggaggctct
gggggctcggctgggggttatggaggagctggaggaggaggtggcagcctcggctttttc
ccctcctccttggcctacagcccctaccagtcgggcgcggccccaatgggctgctacccg
ggaggcgggggtggggcgcagatggccgccgagacgcctagtgtggatgctggggaggaa
gcagcagagccgagcgcgccccccgggacgccccagcgcgaacagcaaaccccggagctg
ctgcatcgagcccgggagtacaacgcacgcctgttcggcctggcgcagcgcagcgctcga
gccttgctggactacggcgtcacggcggacgcacgctcgctgctggcgggacagcgccac
ctgctgactgcacaggatgagaacggagacacgccactgcacttggccatcatccacggg
cagaccaccgtcattgagcagatagcccacgtcatctaccacgccccacacctcggcgtg
gttaatatcaccaatcacttgcaccagacgcccctgcacctggcagtgatcacggggcag
acgaaggtggtgagcttcctgctgcaggtgggcgcagacccagcactgctggatcggcat
ggagactcagcagtgcacctggcactccgggcaggtgccagcgcccccgacatgctgtgc
gccctgctgcggagtggggttcctgccatgccccaactgctgcatgtacccgacttcgaa
gggctatacccagtccacctggcagtccgtgcccgaagccccgaatgcctcgatctgctg
gtggagagtggggctgaagtggaggctgcagagcggcaggggggccggacagccctgcat
ctagccacagagatggaggagctggggttggtcacccatctcgtcaccaagctccgggcc
aacgtgaatgcccgcacctttgcgggaaacacacccctacacttggcagctggactggga
tccccaaccctcacccgcctccttctgaaggctggtgctgacgtccacgcagagaacgag
gagcccctgtgcccactgccttcgcctcccacctctggtagtgactcagattccgagagc
cctgagagggacacccgaggcagcttccggggccacacacctcttgaccycactcgcagc
agcaaggtgaagaccttgctgctaaatgctgctcaggacaccatggcgccgccgctgacc
ccgcccagccctgcagggccagagataccccttgaagatacagtcctacagaacctggag
catctgcttgatgggccaggagcccagggcagctgggtggagctggcagaacggctgggg
ttgcgcagtctggtggacacgtatcgaaggacagcctcgcccagtggcagcctcctgcgc
agttaccagctggctggtggcgactggacgggcctgctgaatgctctgtctgacatgggc
ctggaggagggggtgaggctgctgaagggtccagagacccaggaaaagctgcccagcaca
gcagaggtgaaggaggacagtgcctatgggagccagtcggtggaacaggaaacagagaag
ctgggcccaccccctgagccaccaggagggctctgccacgggcggccccagcctcaggtg
cactga

KEGG   Bos indicus (zebu cattle): 109572909
Entry
109572909         CDS       T04792                                 

Gene name
RELB
Definition
(RefSeq) transcription factor RelB
  KO
K09253  transcription factor RelB
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04064  NF-kappa B signaling pathway
biu04380  Osteoclast differentiation
biu04625  C-type lectin receptor signaling pathway
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109572909 (RELB)
   04064 NF-kappa B signaling pathway
    109572909 (RELB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109572909 (RELB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109572909 (RELB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109572909 (RELB)
   05169 Epstein-Barr virus infection
    109572909 (RELB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109572909 (RELB)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    109572909 (RELB)
SSDB
Motif
Pfam: RelB_transactiv RHD_DNA_bind RelB_leu_zip RHD_dimer
Other DBs
NCBI-GeneID: 109572909
NCBI-ProteinID: XP_019835635
UniProt: A0A6P5DDU5
LinkDB
Position
18
AA seq 563 aa
MPSRRVARSSAAPELGPLGSADLSSLSLAVSRTTDELEIIDEYIKENGFGLEGAQPGPEG
LPRLVSRGAASLSTVTLGPAAPPPPATPPPWGCTLGRXXXXXAGAGPRPHLVITEQPKQR
GMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPH
SLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLK
NHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCT
GGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIVFKTPPYEDLEIVEPVT
VNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELNSSDPHGIESKRRR
KKPVFLDQFLPSHGSGPYLPPSVLLPDTDFYPGTVSLPSLEPPGGPDLLDDSFPYDPAAP
TLLTMLDMLPPAPPLTSAVAGNGGAGAAVGEPPGPEPLTLDSYXXPEPGDGGTASLVGSN
MFPNQYREAGFGGGLLSPGPEAT
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgccgagtcgccgcgtcgccagatcgtccgctgcgccggagctcgggcccttggggtcc
gctgatctctcctcgctctctctcgccgtttccaggaccacggatgaactggagatcatc
gacgagtacatcaaggagaatggcttcggcttggagggggcgcagcccggccccgagggg
ctgccacgcctggtatctcgtggggcggcctccctgagcaccgtcaccctgggccccgcg
gcgcctccgccccctgccacgccgccgccctggggctgcaccctgggccggcnnnnnnnn
nnnnnngcaggcgccgggccgcggccacacctggtcatcaccgagcagcccaagcagcgc
ggcatgcgcttccgctatgagtgcgagggccgctcggccggcagcatcctcggagagagc
agcacggaagccagcaagacgctgcccgccatcgagctccgggactgtggagggctgcgg
gaggtggaggtgaccgcctgcctggtgtggaaggactggcctcaccgagttcatccccac
agcctcgtggggaaagactgcacggacggcgtctgcagggtgcggctccggcctcatgtc
agccctcggcacagctttaacaacctgggcatccagtgtgtgaggaagaaggagatcgag
gctgccatcgagcggaagattcagctgggcattgacccctacaacgctgggtccctgaag
aaccatcaggaggtggacatgaatgttgtgaggatttgcttccaggcctcatacagggat
cagcaaggacagatgcgccggatggaccctgtgctctctgagcccgtctacgacaagaag
tctacaaacacgtcggagctacgaatttgccgaatcaacaaggagagtgggccgtgcacg
ggtggcgaggaactctacctactgtgcgacaaggtgcagaaagaggatatatcggtggtg
ttcagcagagcctcctgggaaggccgggctgacttctcccaggccgatgtgcaccgccag
atcgccattgtgttcaagacaccaccctacgaggacctggagatcgttgaacctgtgaca
gtgaacgtctttctgcagcggcttactgatggggtctgcagtgagcctctgcccttcacc
tacctgcctcgggaccatgacagctatggcgtggacaagaagcggaaacgggggctgcct
gacgtccttggggagttgaatagctctgatccccatggcattgagagcaaacgacggagg
aaaaaaccagtcttcctggatcaattcctgcccagccatggctcaggaccgtacctcccg
ccgtcagtgctgctacccgacacagacttctacccgggcaccgtatccctccccagcctg
gaaccccccggcgggccggacctcctggacgacagctttccctacgaccccgctgccccc
acgctcttgaccatgctggacatgttgcccccagcgccaccactcaccagcgctgtcgcg
ggcaacggcggtgcaggggctgcggtcggggagcctcccggccccgagccgctcacgctg
gactcgtaccannncccggaacccggggacggaggcactgccagcctcgtgggcagcaac
atgttccccaaccagtaccgtgaggccggctttgggggtggcctcctgtccccgggccct
gaggccacgtag

DBGET integrated database retrieval system