KEGG   Bos indicus (zebu cattle): 109553040
Entry
109553040         CDS       T04792                                 

Gene name
BTRC
Definition
(RefSeq) F-box/WD repeat-containing protein 1A isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04114  Oocyte meiosis
biu04120  Ubiquitin mediated proteolysis
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04340  Hedgehog signaling pathway
biu04390  Hippo signaling pathway
biu04710  Circadian rhythm
biu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109553040 (BTRC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109553040 (BTRC)
   04340 Hedgehog signaling pathway
    109553040 (BTRC)
   04390 Hippo signaling pathway
    109553040 (BTRC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109553040 (BTRC)
   04218 Cellular senescence
    109553040 (BTRC)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    109553040 (BTRC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109553040 (BTRC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109553040 (BTRC)
   03036 Chromosome and associated proteins [BR:biu03036]
    109553040 (BTRC)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     109553040 (BTRC)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     109553040 (BTRC)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 F-box Nup160 WD40_like F-box_5 PAN_3 DUF4508 WD40_2
Other DBs
NCBI-GeneID: 109553040
NCBI-ProteinID: XP_019808442
UniProt: A0A6P5B7D4
LinkDB
Position
26
AA seq 641 aa
MDPAEAVLQEKALKFMYHTTIVPGLPLYVARVGMRSRGAKVTELGENSWLLKCSMPRSLW
LGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCA
RLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQW
SESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDARS
LCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPP
NSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNT
IKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCE
AVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASG
DRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEG
HEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFD
EFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggacccggccgaggcggtgctgcaggaaaaagcgctcaagtttatgtaccataccacc
atagttcctggattgcctttgtacgtggccagggtggggatgaggagcagaggagcaaaa
gtcacagaactgggagagaattcctggctgcttaagtgctctatgcccaggtctctgtgg
ctgggctgctccagcctggcggacagcatgccttcgctgcgatgcctgtataacccaggg
actggcgcactcacagctttccagaattcctcagagagagaagactgtaataatggcgaa
ccccctaggaagataataccagagaagaattcacttagacagacatacaacagctgtgcc
agactctgcttaaatcaagagacagtatgtctagcaagcactgctatgaagactgaaaat
tgtgtggccaaaacaaaacttgccaatggcacttccagtatgattgtgcccaagcaacgg
aaactctcagcaagctatgagaaggaaaaggaactgtgtgtcaaatattttgagcagtgg
tcagaatccgatcaagtggaatttgtggaacatcttatatcccaaatgtgtcattaccaa
catgggcacataaactcatatcttaaacctatgttgcagagggatttcataactgctctg
ccagctcggggtttagatcacattgctgagaacatcctgtcatacttggatgccagatca
ctatgtgctgctgaacttgtgtgcaaagaatggtaccgagtgacgtctgatggcatgtta
tggaagaagctcattgaaagaatggtcaggacagattctctgtggagaggcctggcagaa
cgaagaggctggggacagtatttgttcaaaaacaaacctcctgatggaaatgcgcctccc
aactctttttatagagcactttatcctaaaattatacaagacattgagacaatagaatct
aattggagatgtggaagacatagcttacagagaatccactgccgaagtgaaacgagcaaa
ggagtttactgtttacagtatgatgatcagaagatagtaagcggccttcgagacaacaca
atcaagatctgggataaaagcacactggaatgcaagcggattctcacaggccacacaggt
tctgtcctgtgtctccagtatgacgagagagtgatcataactgggtcgtcggattccacg
gtcagggtgtgggatgtaaatacaggtgaaatgctgaacacattgattcaccattgtgaa
gcagttctgcacttgcgtttcaataatggcatgatggtgacctgctccaaagaccgttcc
attgcagtatgggatatggcctccccaactgacatcaccctccgcagggtgcttgtcgga
caccgagctgcagtcaatgttgtagactttgatgataagtacatcgtttctgcatctggg
gataggactataaaggtgtggaacacaagtacttgtgaatttgtacggaccttaaacgga
cacaaacgtggaattgcctgtttgcagtacagagacaggctggtcgtgagtggctcatct
gacaacacaatcagattatgggacatagaatgtggtgcatgcttacgagtgttagaaggc
catgaggaattggtgcgctgtattcgatttgataacaagaggatagtcagtggagcctat
gatggaaaaattaaagtgtgggatcttgtagctgccttggaccctcgtgcgcctgcagga
actctttgtctacggacccttgtggagcattctggaagagttttccgactccagtttgat
gaattccagattgtcagtagttcacatgatgacacaatcctcatctgggacttcctaaat
gatccagctgcccaagctgaacccccccgctccccttctcgaacatacacctatatctcc
agataa

KEGG   Bos indicus (zebu cattle): 109574833
Entry
109574833         CDS       T04792                                 

Gene name
FBXW11
Definition
(RefSeq) F-box/WD repeat-containing protein 11 isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04114  Oocyte meiosis
biu04120  Ubiquitin mediated proteolysis
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04340  Hedgehog signaling pathway
biu04390  Hippo signaling pathway
biu04710  Circadian rhythm
biu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109574833 (FBXW11)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109574833 (FBXW11)
   04340 Hedgehog signaling pathway
    109574833 (FBXW11)
   04390 Hippo signaling pathway
    109574833 (FBXW11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109574833 (FBXW11)
   04218 Cellular senescence
    109574833 (FBXW11)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    109574833 (FBXW11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109574833 (FBXW11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109574833 (FBXW11)
   03036 Chromosome and associated proteins [BR:biu03036]
    109574833 (FBXW11)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     109574833 (FBXW11)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     109574833 (FBXW11)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like F-box WD40_like Nup160 DUF1513 WD40_2 DUF4508
Other DBs
NCBI-GeneID: 109574833
NCBI-ProteinID: XP_019838366
UniProt: A0A6P5DJT1
LinkDB
Position
20
AA seq 563 aa
MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQNTSVMEDQNED
ESPKKSTLWQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRM
CHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVIS
EGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETI
ESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGH
TGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKD
RSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTL
NGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSG
AYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDF
LNVPPSAQNETRSPSRTYTYISR
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggagcccgactcggtgattgaggacaagaccatcgagctcatgtgttctgtgccaagg
tctttgtggctaggctgcgccaacctggtagagagcatgtgcgcactgagttgcctgcag
agcatgcccagtgtcagatgtctccagaacacttcagttatggaggatcaaaatgaagat
gagtccccaaagaaaagtactctttggcagataagtaatggaacatcatcagtgatcgtc
tccagaaagaggccatcagaaggaaactatcaaaaagaaaaagacttgtgtattaaatat
tttgaccagtggtctgaatcagatcaagtggaatttgtggaacaccttatttcacgaatg
tgtcattaccagcatggacatattaactcttacctgaagcccatgttgcagcgggacttt
attaccgctttaccagagcaaggcttagatcacatagcagaaaacattctttcctacctg
gatgccagatctctgtgtgcagcagagctggtgtgtaaagaatggcagcgagtgatctct
gaaggaatgctttggaagaagctgattgaacgaatggtgcgcactgatcctctgtggaag
ggactttcagaaagaagagggtgggatcagtacctgtttaaaaacagaccaacagatggc
cctcccaattcattttataggtcattatacccaaagattatccaggatatagagactata
gagtctaactggcggtgtgggcggcacaacctgcagcggattcagtgtcgctctgagaac
agcaaaggcgtctactgcttacagtatgacgacgagaaaattatcagcggcctgcgagac
aattccattaagatttgggataaaaccagcttggaatgtttgaaagtgttaacgggccac
actggctctgtcctttgtctccagtatgatgaacgtgtcattgtgactggctcttcggac
tccacagtgagagtctgggatgtgaacacaggcgaagttctgaacacgttgatccaccac
aacgaggccgtgctccacttgcgcttcagcaacgggctgatggtgacctgctccaaggac
cgctccatcgccgtgtgggacatggcctctgccaccgacatcactctgcgccgggtcctt
gtcggccaccgggctgcagtcaacgtcgtggactttgacgacaagtacatagtgtccgcc
tctggggacaggaccatcaaagtctggagcacgagcacctgtgagtttgtccgcactctg
aacgggcacaagcgtggcattgcctgcctccagtaccgggaccggctggttgtcagtggg
tcatcagacaataccataaggctgtgggacattgaatgtggcgcctgtttgagagtcctt
gagggacatgaagaattggtccgatgcatccggtttgataacaagaggattgtcagcggg
gcctatgatgggaaaatcaaagtttgggacttgcaagctgctctcgacccgcgagccccg
gcaagcacgttgtgtctgcgcacgctggtggaacactctggacgtgtgtttcggctacag
tttgatgaatttcagatcatcagcagctcgcacgatgacacaattttgatttgggatttc
ttaaatgtgcctcccagtgcccagaatgagacccgttctccctccagaacatacacttac
atctccagataa

DBGET integrated database retrieval system