KEGG   Bos indicus (zebu cattle): 109553057
Entry
109553057         CDS       T04792                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04520  Adherens junction
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05132  Salmonella infection
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05213  Endometrial cancer
biu05215  Prostate cancer
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05221  Acute myeloid leukemia
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109553057 (TCF7L2)
   04390 Hippo signaling pathway
    109553057 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109553057 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109553057 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109553057 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109553057 (TCF7L2)
   05225 Hepatocellular carcinoma
    109553057 (TCF7L2)
   05226 Gastric cancer
    109553057 (TCF7L2)
   05216 Thyroid cancer
    109553057 (TCF7L2)
   05221 Acute myeloid leukemia
    109553057 (TCF7L2)
   05217 Basal cell carcinoma
    109553057 (TCF7L2)
   05215 Prostate cancer
    109553057 (TCF7L2)
   05213 Endometrial cancer
    109553057 (TCF7L2)
   05224 Breast cancer
    109553057 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109553057 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109553057 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109553057 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    109553057 (TCF7L2)
   05165 Human papillomavirus infection
    109553057 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109553057 (TCF7L2)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    109553057 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 109553057
NCBI-ProteinID: XP_019808482
UniProt: A0A6P5B7G9
LinkDB
Position
26
AA seq 521 aa
MKWPLLDVQAGTLQSRQALKDARSPSPAHIVQCPLPCCTQGHDCQHFYPPSDFTVSTQVF
RDMKRSHSLQKVGEPWCLESNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVD
PKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALT
VNASMSSFLSSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSEVGSLHSAKHQDSK
KEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYY
ELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSA
PKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPSSPNLLGSP
PQDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEAAHGKAPALCANGALDLPPAA
LQPPAIPPASLAQPSTSSLHSHGALAGTQPQPLSLVTKSLE
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaaatggccactgcttgatgtccaggcgggaaccctccagagcagacaagccctcaag
gatgctcgctctccgtcgccagcccacatcgttcagtgccccctcccttgctgcactcag
ggacatgactgtcagcacttctaccccccctcagacttcactgtcagcactcaagtcttc
agggacatgaaaaggagccactccttacaaaaggttggggagccctggtgtttggagtcg
aacaaagtgccggttgtgcagcacccgcatcatgtccaccctctcacgcctcttatcacg
tacagcaatgaacacttcacgccgggaaacccacctccacacttaccagctgacgtagac
cccaaaacaggaatcccacggcctccgcaccctccagatatatctccgtactacccactg
tcacctggcaccgtaggacaaatcccccatccgctaggatggttagtaccacagcaaggc
cagcccgtgtaccccatcacgacaggaggattccgtcacccctaccccacagccctgact
gtcaacgcttccatgtccagctttctgtcttctaggttccctccccatatggtcccacca
catcacactctacacacgaccggcattccccacccggccatagtcacgccgaccgtcaaa
caggaatcctctcagagtgaagtcggctcactccacagcgcaaagcatcaggactccaaa
aaggaagaagaaaagaagaagccccacataaagaaacctcttaatgcattcatgttgtat
atgaaggaaatgagagcaaaggttgtagctgagtgcacgttgaaagaaagtgcagccatc
aaccagatcctgggccggaggtggcatgcgctgtcccgagaagagcaagcaaagtaytat
gagctggcccggaargagcgacagcttcacatgcagctgtaccccggctggtccgcacgg
gataactatgggaaaaagaagaagaggaaaagggacaagcagcccggggagaccaatgaa
cacagcgaatgtttcctaaatccttgcctttcacttcctccgattacagacctgagcgct
cctaagaaatgccgagcgcgctttggccttgatcaacagaataactggtgcggcccttgc
aggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagctgcctcagtccaccc
tcttcagatggaagcttactagactcgcctccttcctcccccaacctgctaggctccccc
ccccaggacgccaagtcacagactgagcagacccagcctctctcgctgtccctgaagccc
gaccccctggcccacctgtccatgatgcctccgccgcccgccctcctgcttgccgaggcc
gcccacggcaaggcccccgccctctgtgccaacggggccctggacctgcctcccgccgct
ctgcagccgcctgccatcccccccgcatctctggcacagccgtcgacatcttccttacat
tcccacggcgctctggccgggacccagccccagccactgtccctcgtcaccaagtcttta
gaatag

KEGG   Bos indicus (zebu cattle): 109560266
Entry
109560266         CDS       T04792                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04520  Adherens junction
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05132  Salmonella infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05213  Endometrial cancer
biu05215  Prostate cancer
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05221  Acute myeloid leukemia
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109560266 (LEF1)
   04390 Hippo signaling pathway
    109560266 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109560266 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109560266 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109560266 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109560266 (LEF1)
   05225 Hepatocellular carcinoma
    109560266 (LEF1)
   05226 Gastric cancer
    109560266 (LEF1)
   05216 Thyroid cancer
    109560266 (LEF1)
   05221 Acute myeloid leukemia
    109560266 (LEF1)
   05217 Basal cell carcinoma
    109560266 (LEF1)
   05215 Prostate cancer
    109560266 (LEF1)
   05213 Endometrial cancer
    109560266 (LEF1)
   05224 Breast cancer
    109560266 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109560266 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109560266 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109560266 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    109560266 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109560266 (LEF1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    109560266 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 109560266
NCBI-ProteinID: XP_019817884
UniProt: A0A6P5BX73
LinkDB
Position
6
AA seq 414 aa
MPQLSGAGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQESYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESTSGGKRSSFPTCKAKAATPGPLLEMEAC
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggcaggcggcggcggtgggggggacccggaactctgcgccacg
gacgagatgatccccttcaaggacgagggcgatcctcagaaggagaagatcttcgccgag
atcagtcaccctgaagaggaaggtgacttagccgacatcaagtcttccttggtcaacgaa
tccgaaatcatcccggcgagcaacggacacgaggtggccagacaagcacaaacctctcag
gagtcctaccatgacaaggccagagaacatcctgatgatggaaagcatccagatggaggt
ctctacaataagggaccctcttactcgagttattctggatacataatgatgccaaatatg
aataatgacccatacatgtcaaatggatctctttctccacccatcccaagaacatcaaat
aaagtgcccgtggtgcagccatcccacgcggtccatcctctcacccctctcatcacgtac
agcgacgagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctccagctcccgagatccctacgttttatcccctgtct
ccgggtggtgttggacagattaccccacctcttggctggcaaggtcagcctgtgtatccc
atcacgggaggcttcaggcagccctacccatcctcactgtcagtcgacacttccatgtcc
aggttttctcatcatatgattcctggtcctcccggtccccacacaactggcatccctcat
ccagccattgtaacgcctcaggtcaaacaggaacacccccacactgacagcgacctaatg
cacgtgaagcctcagcatgaacagagaaaggagcaggagccaaaaagacctcacattaaa
aagcctctgaatgcttttatgttatacatgaaagaaatgagagcgaatgtcgtagcygag
tgtactctaaaggaaagtgcagctatcaaccagattctaggcagaaggtggcatgccctc
tctcgtgaagagcaggctaaatattatgaattagcgcggaaggaaagacagctacatatg
cagctctatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaagaga
gagaagctacaggaatccacatcaggtggaaaacgaagttcattcccaacgtgcaaagcc
aaggcagcgaccccgggacctctcctggagatggaagcttgttga

KEGG   Bos indicus (zebu cattle): 109562015
Entry
109562015         CDS       T04792                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X1
  KO
K02620  transcription factor 7
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04520  Adherens junction
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05132  Salmonella infection
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05213  Endometrial cancer
biu05215  Prostate cancer
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05221  Acute myeloid leukemia
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109562015 (TCF7)
   04390 Hippo signaling pathway
    109562015 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109562015 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    109562015 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109562015 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562015 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109562015 (TCF7)
   05225 Hepatocellular carcinoma
    109562015 (TCF7)
   05226 Gastric cancer
    109562015 (TCF7)
   05216 Thyroid cancer
    109562015 (TCF7)
   05221 Acute myeloid leukemia
    109562015 (TCF7)
   05217 Basal cell carcinoma
    109562015 (TCF7)
   05215 Prostate cancer
    109562015 (TCF7)
   05213 Endometrial cancer
    109562015 (TCF7)
   05224 Breast cancer
    109562015 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109562015 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109562015 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109562015 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562015 (TCF7)
   05165 Human papillomavirus infection
    109562015 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109562015 (TCF7)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    109562015 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 109562015
NCBI-ProteinID: XP_019820475
UniProt: A0A6P5C4H3
LinkDB
Position
7
AA seq 284 aa
MYKDTVYSAFNLLMHYPPPSGAGQHPQPQPPLHNKASQPSHGVPQLSPLYDHFSSPHPTP
APADISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPA
PTAAPGAPYPRFTHPPLMLGSGVPGHPAAIPHPAIVPSSGKQELQPYDRSLKAQADSKAE
KEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYEL
ARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESNSDNSLHYS
NT seq 855 nt   +upstreamnt  +downstreamnt
atgtacaaagacaccgtctactccgccttcaatctgctcatgcactacccgcccccctcg
ggagcagggcagcacccccagccgcagcccccgctgcacaacaaggccagtcagccttcc
catggcgtcccccaactttctcctctctatgaccatttcagcagcccacaccccacacct
gcaccagccgacatcagccagaagcaaggagttcacaggcctctgcagacccctgacctc
tctggcttctactctctgacctcaggcagcatgggacagctcccccacactgtgagctgg
cccagccctcctctctaccccctgtccccttcctgcggatatagacagcacttccctgcc
cccaccgcagcccctggcgccccctaccccaggttcacccatccacccctgatgctaggt
tctggtgtccctggtcaccccgcagccatcccccacccagccatcgtgccctcttcaggg
aagcaggagctacagccctatgaccgcagcctgaaagcacaagcagactccaaggcagag
aaggaagccaagaagccaaccatcaagaagccactcaacgccttcatgctatacatgaag
gagatgagagccaaagtcattgcggagtgcacgctcaaggagagtgcagccatcaaccag
atcctgggccgtcggtggcatgcactgtcccgggaagagcaggccaagtattatgagctg
gcccgcaaggagaggcagctgcacatgcagctatacccaggctggtcggcgcgggacaac
tatgggaagaagaagagacggtcgagggaaaagcaccaagaatccaactcagataactct
cttcactattcctag

KEGG   Bos indicus (zebu cattle): 109565564
Entry
109565564         CDS       T04792                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04520  Adherens junction
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05132  Salmonella infection
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05213  Endometrial cancer
biu05215  Prostate cancer
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05221  Acute myeloid leukemia
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109565564 (TCF7L1)
   04390 Hippo signaling pathway
    109565564 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109565564 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109565564 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109565564 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109565564 (TCF7L1)
   05225 Hepatocellular carcinoma
    109565564 (TCF7L1)
   05226 Gastric cancer
    109565564 (TCF7L1)
   05216 Thyroid cancer
    109565564 (TCF7L1)
   05221 Acute myeloid leukemia
    109565564 (TCF7L1)
   05217 Basal cell carcinoma
    109565564 (TCF7L1)
   05215 Prostate cancer
    109565564 (TCF7L1)
   05213 Endometrial cancer
    109565564 (TCF7L1)
   05224 Breast cancer
    109565564 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109565564 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109565564 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109565564 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    109565564 (TCF7L1)
   05165 Human papillomavirus infection
    109565564 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109565564 (TCF7L1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    109565564 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 109565564
NCBI-ProteinID: XP_019825041
UniProt: A0A6P5CGH5
LinkDB
Position
11
AA seq 619 aa
MGRRQARAIKPGGIQRLEDSRHRRSRRVCGSEAFPQGAVPPASARIRSGGSGAGAAGGGD
DLGANDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESENQSSSSDSEAERRPQP
ARDAFQKPRDYFAEVRRPQDGAFFKGPPYPGYPFLMIPDLSSPYLPNGPLSPGGARTYLQ
MKWPLLDVPASATVKDARSPSPAHLSNKVPVVQHPHHMHPLTPLITYSNDHFSPGSPPTH
LSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLSWLVPQQGQPMYSLPPGGFRHP
YPALAMNASMSSLVSSRFSPHMVAPTHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSA
KSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSRE
EQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQQVQETDGALAS
KSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKP
ETRAQLALHSAAFLSSKAAATSSGQMGSQPPLLSRPLPLGSVPTALLTSPPSFPATLHTH
QALPVLQAQPLSLVTKSAH
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgggrcgaaggcaggcgagggcgatcaagccgggagggatccagcgcttagaggactcc
aggcaccgaaggtcccggcgcgtctgcgggtccgaagctttcccgcagggggcagtgccg
cccgctagcgcgcggatccgaagcggcggctcgggcgccggggcagccggcggaggggac
gacctcggggccaacgacgagctgatccccttccaggacgagggaggcgaggagcaggag
ccgagcagcgacagcgcgtcagcgcagcgggacctggacgaagtcaagtcgtccctggtc
aacgagtcggagaaccagagcagcagctcggactcggaggcggagaggcgcccgcagccc
gcccgggacgctttccagaagccacgggactatttcgccgaagtgagaaggccccaggac
ggcgcgttctttaaggggcccccctaccctggctacccgttcctgatgatcccggacctg
agcagcccgtacctccccaacggacccctgtctcccggaggagcgcgcacgtacctgcag
atgaaatggccgctcctcgatgtccccgccagcgccacagtcaaggacgcccggtcaccg
tccccagcacacttgtctaataaagttcctgttgttcagcacccgcaccacatgcatccg
ctgacgcccctcatcacctacagcaaygaccacttctcccccggctcccctcccacacac
ctctccccagagatcgatccaaagacaggaatcccccggccccctcatccatccgagttg
tctccgtattacccactgtctcccggagctgttgggcaaatcccacatcccctcagctgg
ctcgtcccacagcaaggacagcccatgtactcccttcctcctggtggcttcaggcacccc
taccctgccctcgccatgaatgcctcgatgtccagcctggtttccagtcggttctcccct
cacatggtggctccgacccatcctggtctgcccacctcagggatcccccaccccgccatt
gtctcccccattgtcaagcaggaaccagcgccccccagcctgagtccggctgtgagcgcg
aaatcaccagtcacagtgaagaaagaggaagaaaagaagccccacgtgaagaagcctctt
aatgccttcatgttatatatgaaggagatgagggccaaggtggtggctgagtgcaccctg
aaggagagtgcagccatcaaccagatcctggggaggaagtggcacaacctgtcccgagaa
gaacaggccaagtactacgaattggcccggaaggagcggcagcttcactcacagctctac
ccgacctggtcagcccgggacaactacggtaagaaaaagaagaggaagcgagaaaagcag
ctgtcccagacgcagtcccagcagcagcaagtccaagagacagacggtgctctggcctcc
aaaagcaagaagccatgtgtccagtacctgccccccgagaagccctgtgacagccctgct
tcctcgcatggcagcatgctggactccccagctaccccctccgcggccttggcctccccg
gccgccccagccgccacccactcggagcaagcccagcctctctccctcaccaccaagcca
gagacccgggcccagctggctctccactcggctgccttcctgtcatcaaaggctgccgcc
acctcttctggccagatgggcagccagcccccgctcctgtcccggcccctccctttgggg
tccgtgcccacagctctgctgacgtcccctccatccttccccgccacgctccacacccac
caggccctccccgtgctccaggcccagcctctgtccttggtcaccaagtctgcccactaa

DBGET integrated database retrieval system