KEGG   Bos indicus (zebu cattle): 109553089Help
Entry
109553089         CDS       T04792                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00480  Glutathione metabolism
biu00980  Metabolism of xenobiotics by cytochrome P450
biu00982  Drug metabolism - cytochrome P450
biu00983  Drug metabolism - other enzymes
biu01524  Platinum drug resistance
biu05200  Pathways in cancer
biu05204  Chemical carcinogenesis
biu05225  Hepatocellular carcinoma
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109553089
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109553089
   00982 Drug metabolism - cytochrome P450
    109553089
   00983 Drug metabolism - other enzymes
    109553089
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    109553089
   05204 Chemical carcinogenesis
    109553089
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    109553089
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    109553089
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    109553089
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:biu02000]
    109553089
Enzymes [BR:biu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109553089
Transporters [BR:biu02000]
 Other Transporters
  Pores ion channels [TC:1]
   109553089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin Corona_S2
Motif
Other DBs
NCBI-GeneID: 109553089
NCBI-ProteinID: XP_019808557
LinkDB All DBs
Position
26
AA seq 241 aa AA seqDB search
MSGGTVRSLGKGSAPPGPVPEGLIRVYSMRFCPYAKRTLLVLRAKGIRHEVININLKNKP
EWFFKKNPLGLVPVLETSLGQLIYESAITCEYLDEAYPGKKLLPGDPYEKACQKMVFESF
SKVPSLMVSFLRKQNKEDCSGLKEELHKEFSKLEEVLTNKKTTFFGGSSLSMIDYLIWPW
FEWLEALELNECVDHTPNLKLWMASMKNDPIVSSLPTDVKTLQGFFNLYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcggaacggtcagaagcctggggaagggaagcgcgcccccagggcccgtcccc
gagggcctgatccgtgtctacagcatgaggttctgtccttacgccaagaggacgctcctg
gtcctgagggccaagggaatccggcatgaagtcatcaacatcaacctgaaaaataagcct
gagtggtttttcaagaagaatcccttaggcctagtgccggttctggaaaccagtctgggt
cagttgatctatgaatctgccatcacttgtgagtacctggatgaagcatatccagggaag
aagctgttgccaggcgacccctatgagaaagcttgccaaaagatggtctttgagtccttt
tctaaggtaccatctttgatggtaagctttcttagaaagcaaaataaggaagattgctct
ggcctaaaagaagaactgcataaagaattcagcaagctggaggaggttctgactaataag
aagacaaccttctttggtggcagttctctttctatgattgattacctcatctggccctgg
tttgaatggctagaagccttggagttaaatgagtgtgtagaccacactccaaatctaaag
ctctggatggcatccatgaagaatgatcccatagtatcatccctccccaccgatgtgaag
acccttcaaggtttcttcaacctctacttacagaacagccccgaggcctgtgactatggt
ctctga

DBGET integrated database retrieval system