KEGG   Bos indicus (zebu cattle): 109553520
Entry
109553520         CDS       T04792                                 

Gene name
POLB
Definition
(RefSeq) DNA polymerase beta isoform X1
  KO
K02330  DNA polymerase beta [EC:2.7.7.7 4.2.99.-]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03410  Base excision repair
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    109553520 (POLB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109553520 (POLB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109553520 (POLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:biu03400]
    109553520 (POLB)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     109553520 (POLB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.-  
     109553520 (POLB)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     109553520 (POLB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     109553520 (POLB)
SSDB
Motif
Pfam: DNA_pol_B_palm DNA_pol_lambd_f HHH_8 DNA_pol_B_thumb HHH_5 Cdd1 HHH HHH_2 NTP_transf_2
Other DBs
NCBI-GeneID: 109553520
NCBI-ProteinID: XP_019809134
UniProt: A0A6P5BHZ0
LinkDB
Position
27
AA seq 335 aa
MSKRKAPQETLNGGITDMLTELANFEKNVNQAIHKYNAYRKAASVIAKYPHKIKSGAEAK
KLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIK
TLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLSEVKKVDSEYIATVCGS
FRRGAESSGDMDVLLTHPSFTSESAKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQ
LPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRP
LGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgagcaaacggaaggcgccgcaggagactctcaacgggggcatcaccgacatgctcaca
gaactcgcaaactttgagaagaacgtgaaccaggctatccacaaatacaatgcctacaga
aaagcagcatctgtgatagcaaagtacccacacaaaataaagagtggagcggaagctaag
aaactgcctggagtaggaacaaaaattgctgaaaaaattgatgagtttttagctactgga
aaattgcgtaaactggaaaagattcggcaggatgatacgagttcatccatcaatttcctg
actcgagttagtggcattggtccatctgctgcaaggaagtttgtagatgaaggaattaag
acattagaagatctcagaaaaaatgaagataaattgaaccatcatcaacgaattgggcta
aaatattttgaggactttgagaaaagaattcctcgtgaagaaatgttacaaatgcaagat
attgtactaagtgaagttaaaaaagtggattctgaatacattgctacagtctgtggcagt
ttcagaagaggtgcagagtccagtggtgacatggatgtccttctcacccatccaagcttt
acctctgagtcagccaaacagcccaaactgttacatcgtgttgtggagcagttacaaaag
gtccgtttcattacagacactctgtcaaagggtgaaacaaagttcatgggtgtttgccag
cttcccagtaaaaacgatgaaaaggaatatccacacaggagaattgatatcaggttgata
cccaaggatcagtattactgcggtgtcctctatttcactgggagtgatattttcaataag
aatatgagagctcatgccctagaaaaaggcttcacaatcaatgaatacacaatccgtccc
ctgggtgtcactggcgttgccggggagcccctgcccgtggacagtgagaaggacatcttc
gactacatccagtggaaataccgtgagcccaaggaccgaagcgagtga

DBGET integrated database retrieval system