KEGG   Bos indicus (zebu cattle): 109553533
Entry
109553533         CDS       T04792                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu03013  RNA transport
biu04012  ErbB signaling pathway
biu04066  HIF-1 signaling pathway
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04218  Cellular senescence
biu04910  Insulin signaling pathway
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05168  Herpes simplex virus 1 infection
biu05221  Acute myeloid leukemia
biu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109553533 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109553533 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    109553533 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    109553533 (EIF4EBP1)
   04152 AMPK signaling pathway
    109553533 (EIF4EBP1)
   04150 mTOR signaling pathway
    109553533 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109553533 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109553533 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    109553533 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    109553533 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109553533 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109553533 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    109553533 (EIF4EBP1)
   05165 Human papillomavirus infection
    109553533 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109553533 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:biu03019]
    109553533 (EIF4EBP1)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     109553533 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 109553533
NCBI-ProteinID: XP_019809146
UniProt: A0A6P5AXH6
LinkDB
Position
27
AA seq 118 aa
MSGGSSCSQTPSRAIPTTRRVVLADGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPTGDDAPTEARQNHLRSSPEDKPAGGEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtccggaggtagcagctgcagccagaccccgagccgggccatccccaccactcggagg
gtggtcctcgccgacggcgtgcagctgccccctggggactacagcaccacccccggcggc
acgctcttcagcaccacccctggaggtaccaggatcatctatgaccggaagttcctgatg
gagtgtcggaactcacctgtgaccaagacgcccccgcgggacctgcccaccattcccggg
gtcactagccctacaggcgatgatgcccccacggaagccaggcagaatcacctgcgcagc
agccccgaggacaagccggcaggcggtgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system