KEGG   Bos indicus (zebu cattle): 109553732
Entry
109553732         CDS       T04792                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04114  Oocyte meiosis
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04625  C-type lectin receptor signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04720  Long-term potentiation
biu04724  Glutamatergic synapse
biu04728  Dopaminergic synapse
biu04921  Oxytocin signaling pathway
biu04922  Glucagon signaling pathway
biu04924  Renin secretion
biu05010  Alzheimer disease
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05031  Amphetamine addiction
biu05152  Tuberculosis
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109553732 (PPP3CB)
   04310 Wnt signaling pathway
    109553732 (PPP3CB)
   04370 VEGF signaling pathway
    109553732 (PPP3CB)
   04020 Calcium signaling pathway
    109553732 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    109553732 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109553732 (PPP3CB)
   04218 Cellular senescence
    109553732 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109553732 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    109553732 (PPP3CB)
   04660 T cell receptor signaling pathway
    109553732 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    109553732 (PPP3CB)
   04659 Th17 cell differentiation
    109553732 (PPP3CB)
   04662 B cell receptor signaling pathway
    109553732 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    109553732 (PPP3CB)
   04921 Oxytocin signaling pathway
    109553732 (PPP3CB)
   04924 Renin secretion
    109553732 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    109553732 (PPP3CB)
   04728 Dopaminergic synapse
    109553732 (PPP3CB)
   04720 Long-term potentiation
    109553732 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    109553732 (PPP3CB)
   04380 Osteoclast differentiation
    109553732 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109553732 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109553732 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    109553732 (PPP3CB)
   05020 Prion disease
    109553732 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    109553732 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    109553732 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109553732 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109553732 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    109553732 (PPP3CB)
   05163 Human cytomegalovirus infection
    109553732 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109553732 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109553732 (PPP3CB)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109553732 (PPP3CB)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     109553732 (PPP3CB)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 109553732
NCBI-ProteinID: XP_019809378
UniProt: A0A6P5ARG8
LinkDB
Position
28
AA seq 368 aa
MINKLCSFQLLNFFFSLGKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHT
LDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEF
LQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNV
MNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVG
SAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSA
TVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENH
GTGNHGAQ
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgattaacaaattatgcagttttcaattactgaattttttcttttctctaggtaaaatt
aaatattcagaaagagtctatgaagcttgtatggaagcttttgatagcttgcctcttgct
gcacttttaaaccaacaatttctttgtgttcatggtggactttcaccagaaatacacaca
ctggatgatattaggagattagatagattcaaagagccacctgcatttggaccaatgtgt
gacttgctatggtccgatccttctgaagattttggaaatgaaaaatcacaggaacatttt
agtcacaatacagttcgaggatgttcttatttttataactatccagcagtgtgtgaattt
ttgcaaaacaataatttgttatcgattattagagctcatgaagctcaagatgcaggctat
agaatgtacagaaaaagtcaaactacagggttcccttcattaataacaattttttcggca
cctaattacttagatgtctacaataataaagctgctgtattaaagtatgaaaataatgtg
atgaatattcgacagtttaactgttctccacatccttattggttgcccaattttatggat
gttttcacatggtctttaccgtttgttggagaaaaagtgacggaaatgttggtaaacgtt
ctgagtatttgctctgatgatgaacttatgactgaaggcgaagaccagtttgatgtaggt
tcagctgcagcccggaaagaaatcataagaaacaaaattcgagcaattggcaagatggca
agggtcttctctgttctcagggaggagagtgaaagtgtgctgacactcaagggcctgact
cccacagggatgttgcctagtggagtgttggctggaggacggcagaccctgcaaagtgcc
acagttgaggctattgaggctgaaaaagcaatacgaggattctctccaccacatagaatc
tgcagttttgaagaggcaaagggtttggataggatcaatgagagaatgccaccccggaaa
gatgctgtacagcaagatggtttcaattctctgaacaccgcacatgccactgagaaccac
gggactggcaaccatggtgcccagtga

KEGG   Bos indicus (zebu cattle): 109560300
Entry
109560300         CDS       T04792                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04114  Oocyte meiosis
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04625  C-type lectin receptor signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04720  Long-term potentiation
biu04724  Glutamatergic synapse
biu04728  Dopaminergic synapse
biu04921  Oxytocin signaling pathway
biu04922  Glucagon signaling pathway
biu04924  Renin secretion
biu05010  Alzheimer disease
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05031  Amphetamine addiction
biu05152  Tuberculosis
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109560300 (PPP3CA)
   04310 Wnt signaling pathway
    109560300 (PPP3CA)
   04370 VEGF signaling pathway
    109560300 (PPP3CA)
   04020 Calcium signaling pathway
    109560300 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    109560300 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109560300 (PPP3CA)
   04218 Cellular senescence
    109560300 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109560300 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    109560300 (PPP3CA)
   04660 T cell receptor signaling pathway
    109560300 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    109560300 (PPP3CA)
   04659 Th17 cell differentiation
    109560300 (PPP3CA)
   04662 B cell receptor signaling pathway
    109560300 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    109560300 (PPP3CA)
   04921 Oxytocin signaling pathway
    109560300 (PPP3CA)
   04924 Renin secretion
    109560300 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    109560300 (PPP3CA)
   04728 Dopaminergic synapse
    109560300 (PPP3CA)
   04720 Long-term potentiation
    109560300 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    109560300 (PPP3CA)
   04380 Osteoclast differentiation
    109560300 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109560300 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109560300 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    109560300 (PPP3CA)
   05020 Prion disease
    109560300 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    109560300 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    109560300 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109560300 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109560300 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    109560300 (PPP3CA)
   05163 Human cytomegalovirus infection
    109560300 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109560300 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109560300 (PPP3CA)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109560300 (PPP3CA)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     109560300 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 109560300
NCBI-ProteinID: XP_019817946
UniProt: A0A6P5BXA0
LinkDB
Position
6
AA seq 521 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEETV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gtcccatttcctccaagtcaccggcttacggcaaaagaagtgtttgataatgatgggaaa
cctcgtgtggatatcttaaaggcacatctcatgaaggagggcaggctcgaagagactgtc
gcattgagaataataacagagggggcttcaattcttcgacaggaaaaaaacttgctggat
attgatgctccagtcacagtttgtggggacatccatggacaattctttgacttgatgaaa
ctctttgaagtggggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggctttgaaaattctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtatatgatgcctgcatggat
gcctttgactgcctgcccctggctgccctgatgaaccagcagttcctgtgtgtacacggc
ggtttgtctccagagataaacactttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcttatggacctatgtgtgatatcctgtggtcagacccgctggaagattttgga
aacgagaagactcaggaacatttcactcacaacacagtcagggggtgttcatacttctac
agttacccggctgtatgtgaattcttgcagcacaataacttgttatctatcctccgagct
catgaagcccaagatgcagggtaccgcatgtacaggaaaagccaaacaacaggcttcccc
tctctcattacaattttttcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaatgtcatgaatatcaggcaattcaactgttctcctcatcca
tactggcttccaaatttcatggatgttttcacctggtccctgccgtttgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctcagacgatgaactagggtcagaa
gaagatggatttgatggagcaacggctgcagccaggaaggaggtgataagaaataagatc
cgagccattggcaagatggccagagtgttctcggttctcagagaagagagtgagagtgtg
ctgacgctgaaaggcctgacgcccacaggcatgctccccagcggcgtgctttctggaggg
aaacaaaccctgcaaagcgctactgttgaggctattgaggctgatgaagctatcaaagga
ttttcaccacaacataagatcactagcttcgaggaggccaagggcttagaccgaattaay
gagaggatgccacctcgcagagatgccatgccctctgatgccaaccttaactccatcaac
aaggctctcgcctcagagactaacggcacggacagcaatggcagtaatagcagcaatatc
cagtga

KEGG   Bos indicus (zebu cattle): 109563107
Entry
109563107         CDS       T04792                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04114  Oocyte meiosis
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04625  C-type lectin receptor signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04720  Long-term potentiation
biu04724  Glutamatergic synapse
biu04728  Dopaminergic synapse
biu04921  Oxytocin signaling pathway
biu04922  Glucagon signaling pathway
biu04924  Renin secretion
biu05010  Alzheimer disease
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05031  Amphetamine addiction
biu05152  Tuberculosis
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109563107 (PPP3CC)
   04310 Wnt signaling pathway
    109563107 (PPP3CC)
   04370 VEGF signaling pathway
    109563107 (PPP3CC)
   04020 Calcium signaling pathway
    109563107 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    109563107 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109563107 (PPP3CC)
   04218 Cellular senescence
    109563107 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109563107 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    109563107 (PPP3CC)
   04660 T cell receptor signaling pathway
    109563107 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    109563107 (PPP3CC)
   04659 Th17 cell differentiation
    109563107 (PPP3CC)
   04662 B cell receptor signaling pathway
    109563107 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    109563107 (PPP3CC)
   04921 Oxytocin signaling pathway
    109563107 (PPP3CC)
   04924 Renin secretion
    109563107 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    109563107 (PPP3CC)
   04728 Dopaminergic synapse
    109563107 (PPP3CC)
   04720 Long-term potentiation
    109563107 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    109563107 (PPP3CC)
   04380 Osteoclast differentiation
    109563107 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109563107 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109563107 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    109563107 (PPP3CC)
   05020 Prion disease
    109563107 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    109563107 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    109563107 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109563107 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109563107 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    109563107 (PPP3CC)
   05163 Human cytomegalovirus infection
    109563107 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109563107 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109563107 (PPP3CC)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109563107 (PPP3CC)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     109563107 (PPP3CC)
SSDB
Motif
Pfam: Metallophos PTEN_C2 DUF5378
Other DBs
NCBI-GeneID: 109563107
NCBI-ProteinID: XP_019821868
UniProt: A0A6P5C8P7
LinkDB
Position
8
AA seq 533 aa
MGVFYIFSCLNFFFLFFLAVPFPPTQRLSLKEVFENGKPKIDVLKNHLVKEGRLEEEVAL
KIINDGAAILRQEKTMIEVDAPVTVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDR
GYFSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMETF
DCLPLAALLNQQFLCXHGGMSPEITCLDDIRKLDRFKEPPAFGPVCDLLWSDPSEDYGNE
KTLEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQMTGFPSL
ITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVT
EMLVNILNICSDDELISDDELEDHYISSFQKGGTTVRKEIIKNKIRAIGKMARVFSILRE
ESESVLTLKGLTPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHRIRSFEEARG
LDRINERMPPRKDSQYFDGPVKLVQANAAHRSDKGRRASNDSEPCGGTGGSKT
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgggggttttctatatcttcagctgtttaaattttttttttcttttctttctagctgtc
ccctttcctccgacccagcggctttctttgaaggaagtatttgagaatgggaaacctaaa
attgatgttttgaaaaaccatttggtgaaggaagggcgactggaagaggaagtagcctta
aaaataatcaatgatggggctgccatactgagacaagagaagactatgatagaagtagat
gctccagtcacggtatgtggtgacattcatggacaattctttgacctgatgaagttgttt
gaagttggaggatcacctagtaatacacgctacctctttctgggtgactacgtggacaga
ggctatttcagtatagagtgtgtgctgtatttatggagtttaaagatcaatcatcccaaa
acattgtttctgcttcgaggaaatcatgaatgcaggcatcttacagaatattttaccttc
aaacaggaatgtcgaatcaaatattctgaacaggtgtacgatgcgtgtatggaaacattt
gactgtcttcctcttgctgccctcttaaaccagcagtttctgtgtgyacatggaggaatg
tcacctgaaattacttgtttagatgacattcggaaattagacaggtttaaagaacctcca
gcctttgggccagtgtgtgacctgctttggtctgatccctccgaggattatggcaatgaa
aagaccttggaacactatacccacaacactgtccgagggtgctcttatttttacagttac
cctgcagtttgtgaatttctgcagaacaataatttgctctcaataatcagagcccatgaa
gcccaagatgccgggtatcgaatgtacaggaagagccaaatgacgggctttccatcgctc
attacaattttctctgcacccaattacctagatgtctataacaataaagctgctgtgtta
aaatatgaaaacaacgtcatgaatatcaggcagtttaactgttctccacacccctactgg
cttccaaactttatggatgttttcacgtggtctttgccttttgtcggggaaaaagttaca
gagatgctggttaacattctcaacatatgctctgatgatgaattgatttctgatgatgaa
cttgaagatcactacatttcaagctttcagaaaggaggcactacagttcgcaaggagatc
atcaagaataaaatcagagctattgggaagatggcacgggtcttttcaattcttcgggaa
gagagtgagagcgtgctaactctcaagggcctgactcctacagggacactgcctttgggt
gtcctctcaggaggaaagcagactattgagacagccacagtagaagcggtagaggcccgg
gaagccatcagagggttttcgcttcagcacaggatccgaagttttgaagaagcccgaggt
ctcgaccggattaatgagcggatgccaccccgcaaagatagccagtactttgatgggccg
gtgaaactggtccaagccaacgctgcacacaggagcgacaagggaagaagagccagtaat
gactcagagccctgcggtggcactggtggctccaagacttaa

KEGG   Bos indicus (zebu cattle): 109563306
Entry
109563306         CDS       T04792                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04114  Oocyte meiosis
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04625  C-type lectin receptor signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04720  Long-term potentiation
biu04724  Glutamatergic synapse
biu04921  Oxytocin signaling pathway
biu04922  Glucagon signaling pathway
biu04924  Renin secretion
biu05010  Alzheimer disease
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05031  Amphetamine addiction
biu05152  Tuberculosis
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109563306 (PPP3R2)
   04310 Wnt signaling pathway
    109563306 (PPP3R2)
   04370 VEGF signaling pathway
    109563306 (PPP3R2)
   04020 Calcium signaling pathway
    109563306 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    109563306 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109563306 (PPP3R2)
   04218 Cellular senescence
    109563306 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109563306 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    109563306 (PPP3R2)
   04660 T cell receptor signaling pathway
    109563306 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    109563306 (PPP3R2)
   04659 Th17 cell differentiation
    109563306 (PPP3R2)
   04662 B cell receptor signaling pathway
    109563306 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    109563306 (PPP3R2)
   04921 Oxytocin signaling pathway
    109563306 (PPP3R2)
   04924 Renin secretion
    109563306 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    109563306 (PPP3R2)
   04720 Long-term potentiation
    109563306 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    109563306 (PPP3R2)
   04380 Osteoclast differentiation
    109563306 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109563306 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109563306 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    109563306 (PPP3R2)
   05020 Prion disease
    109563306 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    109563306 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    109563306 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109563306 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109563306 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    109563306 (PPP3R2)
   05163 Human cytomegalovirus infection
    109563306 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109563306 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109563306 (PPP3R2)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     109563306 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Other DBs
NCBI-GeneID: 109563306
NCBI-ProteinID: XP_019822223
UniProt: A0A6P5C9T9
LinkDB
Position
8
AA seq 170 aa
MGNEASYPAEICSHFDEDEIKRLRKRFKKLDLDSSSALSVKEFTSMPELQENPLVQRVID
VFDTDGDGQVDFREFILGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV
GDNLKDWQLQQLVDKTIILLDKDGDGKISFQEFSAVVRSLEXHKHLVTIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggccagttacccggcggaratatgctcgcacttcgacgaagatgaaatt
aaaaggctgcgcaagcgttttaagaagctggacttggacagttccagcgctctgagcgtc
aaagagttcacgtccatgccrgagctgcaggagaacccgctggtgcagcgggtgatmgac
gtcttcgacaccgacggcgacggacaggtggacttccgggaattcatcctggggacctcc
cagttcagcgtccggggagatgaggagcagaagctgaggtttgctttcagcatctacgac
atggacaaagacggctacatttccaacggggagctcttccaggtgctgaagatgatggta
ggcgacaacctgaaagactggcagttacagcagctggtggacaaaaccatcatcctcctg
gacaaagacggggacgggaaaatctccttccaggaattcagtgctgtggtcagaagcctg
gagrtccacaagcacttggtgaccattgtgtga

KEGG   Bos indicus (zebu cattle): 109566227
Entry
109566227         CDS       T04792                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04114  Oocyte meiosis
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04625  C-type lectin receptor signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04720  Long-term potentiation
biu04724  Glutamatergic synapse
biu04921  Oxytocin signaling pathway
biu04922  Glucagon signaling pathway
biu04924  Renin secretion
biu05010  Alzheimer disease
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05031  Amphetamine addiction
biu05152  Tuberculosis
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109566227 (PPP3R1)
   04310 Wnt signaling pathway
    109566227 (PPP3R1)
   04370 VEGF signaling pathway
    109566227 (PPP3R1)
   04020 Calcium signaling pathway
    109566227 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    109566227 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109566227 (PPP3R1)
   04218 Cellular senescence
    109566227 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109566227 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    109566227 (PPP3R1)
   04660 T cell receptor signaling pathway
    109566227 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    109566227 (PPP3R1)
   04659 Th17 cell differentiation
    109566227 (PPP3R1)
   04662 B cell receptor signaling pathway
    109566227 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    109566227 (PPP3R1)
   04921 Oxytocin signaling pathway
    109566227 (PPP3R1)
   04924 Renin secretion
    109566227 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    109566227 (PPP3R1)
   04720 Long-term potentiation
    109566227 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    109566227 (PPP3R1)
   04380 Osteoclast differentiation
    109566227 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109566227 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109566227 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    109566227 (PPP3R1)
   05020 Prion disease
    109566227 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    109566227 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    109566227 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109566227 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109566227 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    109566227 (PPP3R1)
   05163 Human cytomegalovirus infection
    109566227 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109566227 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109566227 (PPP3R1)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     109566227 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 109566227
NCBI-ProteinID: XP_019825976
UniProt: A0A6P5CIX1
LinkDB
Position
11
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgcagatgaaatt
aaaaggctaggaaagagatttaagaagctcgatttggacaattctggttctttgagtgtg
gaagagttcatgtctctacctgagttacaacagaatcccttagtacagcgagtaatagat
atattcgacacagatgggaatggagaagtagactttaaagagttcattgagggagtctct
cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac
atggataaagacggctatatttccaatggggaactcttccaggtgctaaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggggatggaagaatatcctttgaagaattctgtgctgttgtaggcggccta
gatatccacaaaaagatggtggtagacgtgtga

DBGET integrated database retrieval system