KEGG   Bos indicus (zebu cattle): 109553919
Entry
109553919         CDS       T04792                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04114  Oocyte meiosis
biu04115  p53 signaling pathway
biu04218  Cellular senescence
biu04540  Gap junction
biu04914  Progesterone-mediated oocyte maturation
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109553919 (CDK1)
   04114 Oocyte meiosis
    109553919 (CDK1)
   04115 p53 signaling pathway
    109553919 (CDK1)
   04218 Cellular senescence
    109553919 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109553919 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109553919 (CDK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109553919 (CDK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109553919 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109553919 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:biu03032]
    109553919 (CDK1)
   03036 Chromosome and associated proteins [BR:biu03036]
    109553919 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109553919 (CDK1)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109553919 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     109553919 (CDK1)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109553919 (CDK1)
DNA replication proteins [BR:biu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    109553919 (CDK1)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109553919 (CDK1)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109553919 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like Kdo Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 109553919
NCBI-ProteinID: XP_019809793
UniProt: A0A6P5BIQ3
LinkDB
Position
28
AA seq 297 aa
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKST
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDSQIKKM
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaagactataccaaaatagagaaaattggagaaggtacctatggagttgtgtataag
ggtagacacaaaactacaggccaagtggtagccatgaagaaaatcagactagaaagtgaa
gaggaaggggttcctagtactgcaattcgggaaatatctctattaaaagagcttcgtcat
ccaaatatagtcagtcttcaagatgtgcttatgcaggattccaggttgtatctcatcttt
gaattcctttccatggatctcaagaaatacttggattctatccctcctggtcagttcatg
gattcttcacttgttaagagttatttgtaccaaatcctacaagggattgtgttttgtcac
tctagaagagttctccacagggacttaaaacctcaaaatctattgattgatgataaagga
acaattaagttggcagattttggccttgccagagcttttggaattcctattagagtatat
acrcatgaggtagtgacactctggtatagatctccagaagtattgctggggtcagctcgc
tactcaactccagtggacatttggagtataggtaccatatttgctgaattagcaacgaag
aaaccactttttcatggggattcagaaattgatcaactcttcagaattttcagagctttg
ggcactcccaataatgaagtgtggccagaagtggaatctttacaggactataagagtaca
tttcccaagtggaaaccaggaagcttagcatcccatgtcaaaaacttggatgaaaatggc
ttggatctgctctcgaaaatgttaatctatgatcctgccaaacgaatttctggcaaaatg
gcactgaatcatccgtactttaatgatttggacagtcaaattaagaagatgtag

DBGET integrated database retrieval system