KEGG   Bos indicus (zebu cattle): 109553931
Entry
109553931         CDS       T04792                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1 isoform X1
  KO
K06279  SHC-transforming protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04510  Focal adhesion
biu04650  Natural killer cell mediated cytotoxicity
biu04722  Neurotrophin signaling pathway
biu04910  Insulin signaling pathway
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04926  Relaxin signaling pathway
biu04935  Growth hormone synthesis, secretion and action
biu05034  Alcoholism
biu05100  Bacterial invasion of epithelial cells
biu05206  MicroRNAs in cancer
biu05214  Glioma
biu05220  Chronic myeloid leukemia
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109553931 (SHC1)
   04014 Ras signaling pathway
    109553931 (SHC1)
   04072 Phospholipase D signaling pathway
    109553931 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109553931 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109553931 (SHC1)
   04062 Chemokine signaling pathway
    109553931 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109553931 (SHC1)
   04915 Estrogen signaling pathway
    109553931 (SHC1)
   04917 Prolactin signaling pathway
    109553931 (SHC1)
   04926 Relaxin signaling pathway
    109553931 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    109553931 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109553931 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    109553931 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109553931 (SHC1)
   05226 Gastric cancer
    109553931 (SHC1)
   05214 Glioma
    109553931 (SHC1)
   05220 Chronic myeloid leukemia
    109553931 (SHC1)
   05224 Breast cancer
    109553931 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    109553931 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    109553931 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109553931 (SHC1)
   01522 Endocrine resistance
    109553931 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 109553931
NCBI-ProteinID: XP_019809819
UniProt: A0A6P5BJ34
LinkDB
Position
3
AA seq 584 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPVLPPVPGDDSPTTLCS
FFPRMSSLKLASPAGGRPGPKGEPGRANEDGEGVAGAATLDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPRLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGALPGAARPTPPSAQTPSHLGATLPVGQPAGGDPEARRQMPPPPPSSAGR
ELFDDPSYVNVQNLDKARQAGAGAGPPNPTINGSAPRDLFDMKPFEDALRMPPPPQSTAM
AEQLRGEPWFHGKLSRREAEALLQVNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtataacccacttcggaatgagtctctgtcatcg
ctggaggagggggcctcagggtccaccccaccggaggagctgccgtccccctcagcctcg
tccctggggcccgtgctgccacctgtgcctggggacgatagccccaccaccctgtgctcc
ttcttcccccggatgagcagcctgaagctggccagcccagctggggggcgcccgggcccg
aagggggagccaggaagggcaaatgaggacggggagggggtcgcaggggcagccacgctg
gactcaggccccctgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggactcgccacgggagcttt
gtcaataagcccacgcggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tcctacttggttcggtacatgggctgtgtggaggtcctgcagtcaatgcgcgcccttgac
ttcaacacccggactcaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgctaagggggcaacaaggaggagaaagccctgtagccgtccactcagctccattctg
gggaggagtaacctgaaatttgctggaatgccaatcactctgaccgtctccaccagcagc
ctcaacctcatggccgcagactgcaaacagatcatcgccaaccaccacatgcagtccatc
tcgtttgcatccggcggggacccggacacagccgagtatgttgcctatgttgccaaagac
ccggtgaatcagagagcctgccacatcctggagtgtcccgaagggctcgctcaggatgtc
atcagcaccatcggccaggccttcgagctgcgcttcaaacagtacctcaggaacccgccc
aggctcgtcaccccccacgacaggatggctggctttgatggctcagcttgggatgaggag
gaggaagagccccctgaccatcagtactataatgacttcccggggaaggaaccacctctt
gggggtgtggtggacatgaggcttcgggaaggagccctcccaggggctgctcgacccact
ccgcccagtgcccagacccccagccacctgggagccacgctgcctgtggggcagcctgct
gggggagacccagaagcccgcagacagatgccgcccccgccacccagctcagcaggcaga
gagctctttgatgacccctcctatgtcaatgtccagaacctagacaaggcccggcaagca
ggggctggggccgggccccccaatcctaccatcaatggcagtgcaccccgagacctcttt
gacatgaagccctttgaagatgccttgcgaatgcctccacctccccagtcaacagccatg
gctgagcagctccgaggggagccctggttccacgggaagctgagccggcgggaggctgag
gcattgctacaagtcaacggggacttcctggtgcgggaaagcacaaccacgccgggccag
tacgtgctcaccggcctgcagagtgggcagcccaagcacctgctcctggtggaccctgag
ggtgtggttcggacaaaggatcaccgctttgagagtgtcagtcacctcatcagctaccac
atggacaatcacttgcccatcatctctgcgggcagcgaactgtgtctccagcagcctgtg
gagcggaaactgtga

KEGG   Bos indicus (zebu cattle): 109561056
Entry
109561056         CDS       T04792                                 

Gene name
SHC2
Definition
(RefSeq) SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04370  VEGF signaling pathway
biu04510  Focal adhesion
biu04650  Natural killer cell mediated cytotoxicity
biu04722  Neurotrophin signaling pathway
biu04910  Insulin signaling pathway
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04926  Relaxin signaling pathway
biu04935  Growth hormone synthesis, secretion and action
biu05034  Alcoholism
biu05100  Bacterial invasion of epithelial cells
biu05214  Glioma
biu05220  Chronic myeloid leukemia
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109561056 (SHC2)
   04014 Ras signaling pathway
    109561056 (SHC2)
   04370 VEGF signaling pathway
    109561056 (SHC2)
   04072 Phospholipase D signaling pathway
    109561056 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109561056 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109561056 (SHC2)
   04062 Chemokine signaling pathway
    109561056 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109561056 (SHC2)
   04915 Estrogen signaling pathway
    109561056 (SHC2)
   04917 Prolactin signaling pathway
    109561056 (SHC2)
   04926 Relaxin signaling pathway
    109561056 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    109561056 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109561056 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109561056 (SHC2)
   05226 Gastric cancer
    109561056 (SHC2)
   05214 Glioma
    109561056 (SHC2)
   05220 Chronic myeloid leukemia
    109561056 (SHC2)
   05224 Breast cancer
    109561056 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    109561056 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    109561056 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109561056 (SHC2)
   01522 Endocrine resistance
    109561056 (SHC2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 109561056
NCBI-ProteinID: XP_019819044
UniProt: A0A6P5C0C1
LinkDB
Position
7
AA seq 433 aa
MEYMGCIEVLRSMRSLDFSTRTQVTREAINRLHEAVPGVRGSWKKKAPNKALASILGKSN
LRFAGMSIAVSISIDGLNLSVPATRQIIANHHMQSISFASGGDTDMADYVAYVAKDPINQ
RACHILECCEGLAQSVISTVGQAFELRFKQYLHSPPRVVVPPERLTGMEDSAWGDEEEVE
HNYYNSLPGKEPPPGGLVDSRLALTQPCALGVLGALGQGASPARRDTRGLQWDVGPSVPA
QPGDGYVQADXRGPRDYEDHLYVNTQGLDGPESLQPEDSPKKDLFDMRPFEDALRLHECS
VAAGSVAAPLPVEDQWPSPPTRRAPIAPTEEQLRQEPWYHGQMSRRAAEKLLRADGDFLV
RDSVTNPGQYVLTGMHGGQPKHLLLVDPEGVVRTKDVLFESISHLIDYHLQNGQPIVAAE
SELHLRGVVKREP
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggagtacatgggctgcatcgaggtgctccgttccatgcgctccctggacttcagcaca
cgcacccaggtcaccagggaagccatcaaccggctccatgaggcggtgcctggcgtccgg
ggctcctggaagaagaaggcccccaacaaggccctggcctcaatcttgggcaagagcaac
ctgcgcttcgcgggcatgagcattgcggtcagcatctccatcgacggcctcaacctctcc
gtgcccgccacgcgccagatcatcgccaatcatcacatgcagtccatctccttcgcgtcc
ggtggtgacacggacatggcggattatgtggcctacgtggccaaggaccccatcaaccag
agagcctgtcacatcctggagtgctgtgagggccttgcccagagcgtcatcagcaccgtg
ggccaagccttcgagctgcgcttcaaacagtacctgcacagcccccccagggtcgtcgtc
cccccggaaaggctgaccgggatggaggactcggcctggggggatgaagaggaggtggaa
cacaactactacaacagcctccccgggaaggagccgcccccaggagggctggtggactcc
aggctcgccctcacacagccctgtgccctgggggtcctcggtgcccttggccagggagcc
tctcctgctcgaagagacacccgcggcctgcagtgggatgtaggcccctcagtcccagcc
cagcccggggatggctatgtgcaggcggacrcccggggcccccgagactacgaggaccat
ctgtatgtcaacacgcagggtctggacggccctgagtcccttcagcccgaggacagcccc
aagaaggatctgttcgacatgcgaccctttgaggatgccctgaggctgcatgagtgctct
gtggcggctggctcggtggcagccccccttcccgtggaggatcagtggcccagccccccg
acccgccgggcccccatcgcccccacggaggagcagctgcgtcaggagccctggtaccat
ggccagatgagccgtcgggcggcggaaaaactgcttcgggcagacggggacttcctcgtg
cgggacagcgtcaccaatcctgggcagtacgtcctcaccggcatgcacggggggcagccc
aagcacctgctgctggtggaccctgagggcgtggtgcggacgaaggacgtgctctttgag
agcatcagccacctgatcgactaccacctgcagaatgggcagcccattgtagccgctgag
agtgagctgcacttgcgaggcgtcgtcaagcgggagccctga

KEGG   Bos indicus (zebu cattle): 109562580
Entry
109562580         CDS       T04792                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04510  Focal adhesion
biu04650  Natural killer cell mediated cytotoxicity
biu04722  Neurotrophin signaling pathway
biu04910  Insulin signaling pathway
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04926  Relaxin signaling pathway
biu04935  Growth hormone synthesis, secretion and action
biu05034  Alcoholism
biu05100  Bacterial invasion of epithelial cells
biu05214  Glioma
biu05220  Chronic myeloid leukemia
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109562580 (SHC3)
   04014 Ras signaling pathway
    109562580 (SHC3)
   04072 Phospholipase D signaling pathway
    109562580 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109562580 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109562580 (SHC3)
   04062 Chemokine signaling pathway
    109562580 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109562580 (SHC3)
   04915 Estrogen signaling pathway
    109562580 (SHC3)
   04917 Prolactin signaling pathway
    109562580 (SHC3)
   04926 Relaxin signaling pathway
    109562580 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    109562580 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109562580 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109562580 (SHC3)
   05226 Gastric cancer
    109562580 (SHC3)
   05214 Glioma
    109562580 (SHC3)
   05220 Chronic myeloid leukemia
    109562580 (SHC3)
   05224 Breast cancer
    109562580 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    109562580 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    109562580 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109562580 (SHC3)
   01522 Endocrine resistance
    109562580 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 109562580
NCBI-ProteinID: XP_019821175
UniProt: A0A6P5C6H1
LinkDB
Position
8
AA seq 454 aa
MDVVFXSLTHDLHFLSLQYLGCIEVLRSMRSLDFSTRTQITREAISRVCEAVPGSKGAFR
KRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMQSISFASGGD
PDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQAFELRFKQYLQCPSKIAALHD
RMQSLDEPWTEEESDGSDHPYYNSIPSKTPPPGGFADARLKARPHGPDTAQFAGKEQTYY
QGRHLGDPFGEDWQQTPVRQGSLDIYSMPEGKSHVAPTGEAPTYVNTQRIPQQTGPATGS
SAESSPRKDLFDMKPFEDALKIQSLGPVLSKAASMECISPVSPRAPDAKMLEELKAEPWY
QGEMSRKEAEGLLKRDGDFLVRKSTTNPGSFVLTGMHNGQAKHLLLVDPEGTIRTKDRIF
DSISHLINHHLENSLPIVSAGSELCLQQPVERNP
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggatgtggtattcgmttctctgactcatgacttacattttctctccttgcagtatctg
gggtgcattgaagttcttcgctccatgaggtctcttgacttcagtacaaggacgcaaatt
accagggaagccatcagccgggtttgtgaagctgtccctggatccaagggagccttcagg
aagagaaagcctccgagcaaaatgttgtctagcatcttgggcaagagcaacctccagttt
gcaggcatgagcatttccctgaccatttccaccgccagcctgaacctgcggacgccggac
tccaaacagattatagcgaatcatcatatgcagtccatctccttcgcctccgggggagac
ccggacacaacagactacgttgcgtatgttgctaaggaccctgttaatcgcagagcttgt
cacattctggagtgttgtgatgggctggcccaggatgtcatcggctccatcggacaagcc
tttgagctccggtttaagcagtatttgcagtgtccttccaagatcgcggctcttcatgac
cgaatgcagagtctagatgaaccatggactgaagaggagagtgatggctcagaccaccca
tattacaacagcattccaagcaagacacctcctccaggggggtttgccgatgctcgcctg
aaagccagaccccacggtcctgacacagcccagtttgcaggaaaagagcaaacttactac
cagggaagacacttaggagacccgtttggtgaagactggcagcaaacacctgtcaggcaa
ggatccttggacatctacagcatgcctgaagggaaatcacatgtggctcctacgggagaa
gcccccacctatgtcaatacccagcgtatcccccagcagacagggccggccacgggcagc
agtgcagagagcagtccgcggaaagacctctttgacatgaagccttttgaagatgctctc
aagattcagtccttgggkcctgtgttgagcaaggcagcctccatggaatgcatcagcccc
gtctcacccagagcaccagatgccaagatgctggaagaactgaaagcagagccttggtac
caaggggagatgagcaggaaggaggcagaggggctgctaaagagagatggagacttcttg
gtcaggaagagtaccaccaacccgggatccttcgtcctcactggcatgcacaatggccag
gccaaacacttgctgctcgtggacccagaaggcacgatccggacaaaggacaggatcttt
gacagtatcagccacctcatcaaccaccacctggaaaacagcctgcccatcgtctccgcc
gggagcgagctctgcctgcagcagccagtggagaggaacccgtga

KEGG   Bos indicus (zebu cattle): 109565147
Entry
109565147         CDS       T04792                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04510  Focal adhesion
biu04650  Natural killer cell mediated cytotoxicity
biu04722  Neurotrophin signaling pathway
biu04910  Insulin signaling pathway
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04926  Relaxin signaling pathway
biu04935  Growth hormone synthesis, secretion and action
biu05034  Alcoholism
biu05100  Bacterial invasion of epithelial cells
biu05206  MicroRNAs in cancer
biu05214  Glioma
biu05220  Chronic myeloid leukemia
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109565147 (SHC4)
   04014 Ras signaling pathway
    109565147 (SHC4)
   04072 Phospholipase D signaling pathway
    109565147 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109565147 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109565147 (SHC4)
   04062 Chemokine signaling pathway
    109565147 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109565147 (SHC4)
   04915 Estrogen signaling pathway
    109565147 (SHC4)
   04917 Prolactin signaling pathway
    109565147 (SHC4)
   04926 Relaxin signaling pathway
    109565147 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    109565147 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109565147 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    109565147 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109565147 (SHC4)
   05226 Gastric cancer
    109565147 (SHC4)
   05214 Glioma
    109565147 (SHC4)
   05220 Chronic myeloid leukemia
    109565147 (SHC4)
   05224 Breast cancer
    109565147 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    109565147 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    109565147 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109565147 (SHC4)
   01522 Endocrine resistance
    109565147 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 109565147
NCBI-ProteinID: XP_019824433
UniProt: A0A6P5CG62
LinkDB
Position
10
AA seq 630 aa
MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSPGVSTGSKGSPQPPY
PTLAPHLPAEDAALASQESPTPLCTLIPRMASVKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSPASPETSLNRAVPAPPPQRDPLGHRATSLTPDACPLPGPGEPTPRNRQDRH
FVQHLLGLGMNYYVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPAKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRNGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEV
PVDGHAEEREDHEYYNEIPGKQPPAGGVSDVRIKVQVTEQMAYCPIRCEKLCYLPGSSKS
SSMYENCLEQSRAIGNAHERGVPSQREASLMKHSCGADLFDDPCYINTQALRSTLGPAGN
QSSPHPLGSPWPQETAPETVQPGATAQPASSHSLPHIKQQLRNEDCYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPGLLHPNK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgagaacgcggtcaggacagcctggcaggactcgtgctatatgtaggactcttcggg
caccccgggatgctgcacagggccaagtacagccgctttcggaatgagtccatcacgtcc
ttggacgaaggcagcccgggagtctcgaccgggagcaagggctcgccgcagcctccttac
cccaccctggcacctcacctgcccgctgaagatgctgccttggcctcccaggagagcccc
accccattgtgcaccttgatccctcgcatggccagcgtaaagctggccaacccagccacc
ttgctgagtctgaaaaacttttgtttgggtaccaaagaggtacctcgactcaagctccag
gaaagccaggacccggctcccagcagcccggcttcccctgaaaccagtctcaatagggct
gtgccagcacctccgcctcagcgggaccccctggggcacagggcgacctctttaactcct
gacgcctgcccacttcccggccctggggaaccaaccccccggaacagacaggacagacac
tttgtgcagcacctgttggggctgggcatgaactactatgtgaggtacatgggctgtatt
gaagtgctgcaatcaatgagatcactggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccctggggcaaatggagccattaaaaagcgaaag
cctccagctaagttcctatcaacagttcttggcaaaagtaatcttcagttttcgggaatg
aatataaaactgaccatctcaacatgcagtctcacactgatgaatcttgacaaccaacag
attattgcaaatcatcatatgcagtctatttcttttgcttctggaggggatccggatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgccacatactg
gaatgccgcaatggaatggcccaggacgtcataagtaccataggacargctttcgaactc
cggtttaaacagtatttgaaaaatccttctttgaatacttcttgtgaaagtgaggaggtg
cctgtggatggccatgctgaggagagagaagatcatgagtattataatgaaatcccgggg
aagcagccgcctgcaggtggtgtttcagatgtgcggatcaaagttcaagtcacagagcaa
atggcttactgccccatacggtgtgaaaagctgtgctatttgcctggaagctccaagagc
agcagcatgtatgagaactgtctggaacaaagcagggctataggtaatgcacacgagaga
ggggtgccttcccagcgagaggcgtcactgatgaagcactcatgtggggcggatcttttc
gatgacccctgctacatcaatacacaggctcttcgaagcacacttggccctgctggaaat
caaagctcacctcaccccctggggagcccgtggccccaggagacagcaccagaaactgtt
cagccaggtgccacggcccagcctgccagctcacattctttgccacacattaagcagcag
ctgcggaatgaagactgctaccatggcaagctgagcaggaaagcagcagagagccttttg
gtgaaggatggggactttttagttcgagagagtgcaacgtctcctggccagtatgtgctg
agtgggctacagggaggccaggcaaaacatcttctcctggtggatcctgaaggcaaggtg
aggaccaaggatcatgtatttgataatgttggccaccttatcagataccacatggataat
agtttgccaatcatctcttctggaagtgaagtaagccttaaacaaccagtgagaaaagat
aataatccaggacttttgcatcctaacaaatga

DBGET integrated database retrieval system