KEGG   Bos indicus (zebu cattle): 109554138
Entry
109554138         CDS       T04792                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha
  KO
K05055  interleukin 6 receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04066  HIF-1 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04659  Th17 cell differentiation
biu04932  Non-alcoholic fatty liver disease
biu05163  Human cytomegalovirus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109554138 (IL6R)
   04066 HIF-1 signaling pathway
    109554138 (IL6R)
   04151 PI3K-Akt signaling pathway
    109554138 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109554138 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109554138 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109554138 (IL6R)
   04659 Th17 cell differentiation
    109554138 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109554138 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109554138 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    109554138 (IL6R)
   05163 Human cytomegalovirus infection
    109554138 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109554138 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109554138 (IL6R)
   04090 CD molecules [BR:biu04090]
    109554138 (IL6R)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL6/12 receptor family
   109554138 (IL6R)
CD molecules [BR:biu04090]
 Proteins
  109554138 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 Ig_2 ig fn3 Ig_5 I-set Ig_6
Other DBs
NCBI-GeneID: 109554138
NCBI-ProteinID: XP_019810009
UniProt: A0A6P5BJG0
LinkDB
Position
3
AA seq 464 aa
MLAVRCALLTALLAASGTALVLKGCPALEVASDVLTSVPGANVTLTCPGGGPEDNATVHW
VLRDQMTGSHHGRPAGVGRRLLLQSVQLSDSGNYSCYREDHPAGSVRLVVDVPPEKPQIS
CIQKSPLSRVNCEWSPRSPPSLTTKAVLLVKKFPKQVFQEPCQYSPESQRFSCQLAVPEG
DSSFYVLSLCVANSAGNKSSNPLGFDGYKLLQPDPPVNITVSAVDRNPRWLSVTWQDPPS
WNSYYYRLQFELRYRTERSETFTTLMLKDPQYHCIINDAWSGMRHVVQLRAQEEFGNGLW
SEWSPEVTGTPWTESRSSTTTKLPTSTQAPTTTEDNENIFSKDSAKTTSLPVQDSTSVPL
PAFLVAGGSLAFGTLLCIGIILRFKKTGKLQALKEGKTSAHPSYSLGQLVPERPKPTPAL
VPLISPPVSPSSLESDNTSRNSRPDAKGPGSPYDVSNRDYFFPR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgctggccgtccgctgcgcgctgctgaccgccctcctcgccgcgtccgggacggcgctg
gtcttgaagggctgccccgcgctggaggtggcgagcgatgtgctgaccagcgtgccaggg
gccaatgtcaccctgacctgcccaggtgggggaccagaggacaatgccacagttcactgg
gtgctcagggatcagatgacaggctcgcaccacggcagaccggctggcgtgggaaggcgg
ctgcttttgcagtccgtgcagctcagcgactccggaaactattcatgctaccgggaagac
cacccagctgggagcgtgcgcttggtggtggatgttcccccggagaagccccagatctcc
tgcatccagaagagccccctcagtagagtgaattgtgagtggagtcctcggagccctcca
tcccttaccaccaaggccgtgttactggtgaaaaagtttccgaagcaagtcttccaggag
ccctgccagtattcccccgagtcccagcgcttctcctgccagttggctgtccctgaggga
gatagctctttctacgtattgtccctgtgtgtcgccaacagtgccgggaacaagtccagc
aaccccctaggatttgacggctacaaactcctacagcccgacccacccgtcaacatcaca
gtcagcgccgtggacagaaacccccgctggctcagtgtcacctggcaggaccccccctcc
tggaactcatattactacaggctacagtttgagctccgataccggactgaacggtcagag
acattcacaacactgatgctgaaggatccgcagtaccactgcatcatcaatgatgcctgg
agtggcatgaggcatgtggtgcagcttcgggcgcaggaggaatttgggaatggcttgtgg
agcgagtggagccccgaggtcaccggcaccccttggacagagtccaggagttctactacg
accaagctgcccacctccacgcaggcacctactactactgaagataatgaaaatattttc
tccaaagattctgcaaaaacaaccagcctcccagtgcaagattctacttcggtaccactg
cccgcattcctggtggctggaggaagcctggcctttgggaccctcctctgcatcggcatc
atcctgaggttcaagaagacggggaaactgcaggctctgaaagaaggcaagacaagtgca
cacccgtcgtattctttgggccagctggttcctgagaggcccaagcctaccccagcgctt
gtccccctcatctccccaccggtgtcccccagcagccttgaatctgacaacacatcgagg
aacagccggccggatgctaagggccctggaagcccttatgacgtcagcaacagagactac
ttcttccccagataa

DBGET integrated database retrieval system