KEGG   Bos indicus (zebu cattle): 109554138
Entry
109554138         CDS       T04792                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha
  KO
K05055  interleukin 6 receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04066  HIF-1 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04659  Th17 cell differentiation
biu04932  Non-alcoholic fatty liver disease
biu05163  Human cytomegalovirus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109554138 (IL6R)
   04066 HIF-1 signaling pathway
    109554138 (IL6R)
   04151 PI3K-Akt signaling pathway
    109554138 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109554138 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109554138 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109554138 (IL6R)
   04659 Th17 cell differentiation
    109554138 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109554138 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109554138 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    109554138 (IL6R)
   05163 Human cytomegalovirus infection
    109554138 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109554138 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109554138 (IL6R)
   04090 CD molecules [BR:biu04090]
    109554138 (IL6R)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL6/12 receptor family
   109554138 (IL6R)
CD molecules [BR:biu04090]
 Proteins
  109554138 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 Ig_2 ig fn3 Ig_5 I-set Ig_6
Other DBs
NCBI-GeneID: 109554138
NCBI-ProteinID: XP_019810009
UniProt: A0A6P5BJG0
LinkDB
Position
3
AA seq 464 aa
MLAVRCALLTALLAASGTALVLKGCPALEVASDVLTSVPGANVTLTCPGGGPEDNATVHW
VLRDQMTGSHHGRPAGVGRRLLLQSVQLSDSGNYSCYREDHPAGSVRLVVDVPPEKPQIS
CIQKSPLSRVNCEWSPRSPPSLTTKAVLLVKKFPKQVFQEPCQYSPESQRFSCQLAVPEG
DSSFYVLSLCVANSAGNKSSNPLGFDGYKLLQPDPPVNITVSAVDRNPRWLSVTWQDPPS
WNSYYYRLQFELRYRTERSETFTTLMLKDPQYHCIINDAWSGMRHVVQLRAQEEFGNGLW
SEWSPEVTGTPWTESRSSTTTKLPTSTQAPTTTEDNENIFSKDSAKTTSLPVQDSTSVPL
PAFLVAGGSLAFGTLLCIGIILRFKKTGKLQALKEGKTSAHPSYSLGQLVPERPKPTPAL
VPLISPPVSPSSLESDNTSRNSRPDAKGPGSPYDVSNRDYFFPR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgctggccgtccgctgcgcgctgctgaccgccctcctcgccgcgtccgggacggcgctg
gtcttgaagggctgccccgcgctggaggtggcgagcgatgtgctgaccagcgtgccaggg
gccaatgtcaccctgacctgcccaggtgggggaccagaggacaatgccacagttcactgg
gtgctcagggatcagatgacaggctcgcaccacggcagaccggctggcgtgggaaggcgg
ctgcttttgcagtccgtgcagctcagcgactccggaaactattcatgctaccgggaagac
cacccagctgggagcgtgcgcttggtggtggatgttcccccggagaagccccagatctcc
tgcatccagaagagccccctcagtagagtgaattgtgagtggagtcctcggagccctcca
tcccttaccaccaaggccgtgttactggtgaaaaagtttccgaagcaagtcttccaggag
ccctgccagtattcccccgagtcccagcgcttctcctgccagttggctgtccctgaggga
gatagctctttctacgtattgtccctgtgtgtcgccaacagtgccgggaacaagtccagc
aaccccctaggatttgacggctacaaactcctacagcccgacccacccgtcaacatcaca
gtcagcgccgtggacagaaacccccgctggctcagtgtcacctggcaggaccccccctcc
tggaactcatattactacaggctacagtttgagctccgataccggactgaacggtcagag
acattcacaacactgatgctgaaggatccgcagtaccactgcatcatcaatgatgcctgg
agtggcatgaggcatgtggtgcagcttcgggcgcaggaggaatttgggaatggcttgtgg
agcgagtggagccccgaggtcaccggcaccccttggacagagtccaggagttctactacg
accaagctgcccacctccacgcaggcacctactactactgaagataatgaaaatattttc
tccaaagattctgcaaaaacaaccagcctcccagtgcaagattctacttcggtaccactg
cccgcattcctggtggctggaggaagcctggcctttgggaccctcctctgcatcggcatc
atcctgaggttcaagaagacggggaaactgcaggctctgaaagaaggcaagacaagtgca
cacccgtcgtattctttgggccagctggttcctgagaggcccaagcctaccccagcgctt
gtccccctcatctccccaccggtgtcccccagcagccttgaatctgacaacacatcgagg
aacagccggccggatgctaagggccctggaagcccttatgacgtcagcaacagagactac
ttcttccccagataa

KEGG   Bos indicus (zebu cattle): 109555190
Entry
109555190         CDS       T04792                                 

Gene name
IL2RG
Definition
(RefSeq) cytokine receptor common subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04144  Endocytosis
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05321  Inflammatory bowel disease
biu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109555190 (IL2RG)
   04151 PI3K-Akt signaling pathway
    109555190 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109555190 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109555190 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109555190 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109555190 (IL2RG)
   04659 Th17 cell differentiation
    109555190 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109555190 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109555190 (IL2RG)
   05340 Primary immunodeficiency
    109555190 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109555190 (IL2RG)
   05162 Measles
    109555190 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109555190 (IL2RG)
   04090 CD molecules [BR:biu04090]
    109555190 (IL2RG)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL2 receptor family
   109555190 (IL2RG)
CD molecules [BR:biu04090]
 Proteins
  109555190 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 109555190
NCBI-ProteinID: XP_019811392
UniProt: A0A6P5BF61
LinkDB
Position
X
AA seq 379 aa
MLKPPLPLRSLLFLQLPLLGVGLNPKFLTPSGNEDIGGKPGTGGDFFLTSTPAGTLDVST
LPLPKVQCFVFNVEYMNCTWNSSSEPQPNNLTLHYGYRNFNGDDKLQECGHYLFSEGITS
GCWFGKKEIRLYETFVVQLQDPREHRKQPKQMLKLQDLVIPWAPENLTLRNLSEFQLELS
WSNRYLDHCLEHLVQYRSDRDRSWTEQSVDHRHSFSLPSVDAQKLYTFRVRSRYNPLCGS
AQHWSDWSYPIHWGSNTSKENIENPENPSLFALEAVLIPLGSMGLIVSLICVYCWLERTM
PRIPTLKNLEDLVTEYQGNFSAWSGVSKGLAESLQPDYSERLCHVSEIPPKGGEGPGGSP
CSQHSPYWAPPCYTLKPEP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgttgaagccaccgttgccactcagatccctcttatttctccagctacctctgctgggg
gtggggctgaacccaaagttcctcacgcccagtggcaatgaagacattggtgggaaacct
gggactggaggagacttcttcctgacttcaacacccgctgggaccctcgatgtttctact
ctgcccctcccaaaggttcagtgttttgtgttcaatgtggagtatatgaattgcacttgg
aacagcagctctgagccccagcccaacaacctgactctgcattatgggtacaggaacttt
aatggtgatgataaactccaggagtgtggccactatctattctctgaaggaatcacttct
ggctgttggtttggaaaaaaggagatccgtctctacgaaacgtttgttgtccagctccag
gacccacgggaacaccggaagcagcccaaacagatgctaaaactgcaggatctggtaatc
ccctgggctccggagaacctgacgcttcgcaacctgagtgaattccagctagaactgagc
tggagcaacagatacttggaccactgtctggagcacctggtgcagtaccggagtgaccgg
gaccgaagctggacggaacaatccgtggaccacaggcatagcttctctctgcctagcgtg
gatgcacagaaactctacacgttccgtgttcggagccgttataacccactttgcggaagt
gctcagcactggagtgactggagctacccaattcactggggcagcaatacttcaaaagag
aatattgagaatccagaaaatccttccttgtttgcattggaagctgtgctgatccctctt
ggctccatgggattgattgtgagcctcatctgtgtgtactgctggctggaacggacaatg
ccccgaattcctactctcaagaacctagaggatctggttactgaataccaaggaaacttc
tcggcctggagtggtgtatctaagggactggccgagagtctgcagccagactacagtgaa
cggctctgccacgtcagtgagatcccccccaaaggaggggaagggcctgggggctccccc
tgcagccagcacagcccctactgggctcctccatgttataccctgaaacctgagccctga

KEGG   Bos indicus (zebu cattle): 109556179
Entry
109556179         CDS       T04792                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin-12 receptor subunit beta-2
  KO
K05064  interleukin 12 receptor beta-2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu05200  Pathways in cancer
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109556179 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109556179 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109556179 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109556179 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109556179 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109556179 (IL12RB2)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL6/12 receptor family
   109556179 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind
Other DBs
NCBI-GeneID: 109556179
NCBI-ProteinID: XP_019812857
UniProt: A0A6P5BHS3
LinkDB
Position
3
AA seq 861 aa
MAHTVGGCSLALIFIIMLLLVKAKIDVCKRGDVTVQPSHVISLGSAVNISCSLKPKQGCL
PSSSFNKLILYKFDRRIYVQHGHSLSSQVKGLPLGTTLFVCKLACSSSDEIRICGAEISV
GVVPEQPRNLSCIQKGERGTVICTWHRGRDTHLYTAYTLQLNGPKNLTWQKQCNDHYCDH
LDLGINLTPESLESSYTVKVTAINSLGSASSFPFSFTLLDIVRPLPPWDIRIKFVNASVD
RCTLLWRDEGLVLLNRLRYRPINSRSWNMVNVTNAKGRHDLLDLKPFTEYEFQISSKLHL
YKGSWSDWSESLRTQTPEEEPIGMLNVWYMRQHIDYNRQQISLFWKNLSLSEARGKILHY
QVTLQKVAGGEITLQNITEHTSWTWVIPRTGNWAAAVSAANSKGSSLPTRINITDLCGAE
LLAPQQVLAKSEGMDKLMVTWTPPEKATAAVQEYVVEWRELHPGAGMQPPLGWLWSPPYR
LSALISENIKPYICYEIRVHALAGDQGGCNSTRGNSQHKAPLSGPHINAISEEKGSVLIS
WDEIPAREQMGCILHYRIYWKERDSNSQPQLCEIPYRISPNSHPIDSLQPRVTYVLWMTA
LTAAGESPQGNEREFCLQGKANWSTFVAPSICMAVIMVGVLSMRCFRQKVFVLLLALRPQ
WCSKEIPDPANSTWAKKYPIVEEKTQLALDRLLTEWPTPEEPEPLVINEVLCRVTPVFRP
PHHRSWSEKGQGVQGHYTSEEDTGYSASSPPPPRAPTAETGQGVDLYKVLGSKGPDSKPG
NPASPLTILPVDYLPTHDGYLPSNMDYLPSHEAPITDPLEELPQHISLSIFPSSSLRPLT
FSCGEKLTLDQLKMGCGSLML
NT seq 2586 nt   +upstreamnt  +downstreamnt
atggcacatacagttggcgggtgctccctggcacttatttttatcatcatgttgctgtta
gttaaggcaaaaatagatgtgtgcaagagaggggatgtgactgtgcagccttcccatgtc
atttcattaggatcagctgtcaacatttcctgctctttgaagcccaaacaaggctgcttg
ccatcctccagtttcaacaagttaatcctctacaagttcgacagaagaatttatgttcag
catggtcactccctcagttctcaagtcaaaggtcttccccttggcacaaccctgtttgtc
tgcaagctggcctgcagcagcagtgacgagattcgaatatgtggggcagagatctccgtc
ggggttgttccagaacagcctcgaaacttatcttgcatacagaagggagaacgtggaact
gtgatctgcacctggcacagagggcgagacacccacctgtacactgcatacactttacag
ttaaatggaccaaaaaatttaacttggcaaaagcaatgtaatgatcactattgtgatcat
ttggaccttggaatcaacctaacccctgaatcacttgaatctagttacacagtcaaggtt
actgctatcaatagtcttgggagtgcttcttcatttccattctcattcacattgctggac
atagtgaggcctcttcctccgtgggacatcagaatcaaatttgtaaatgcttccgtggac
aggtgtacccttctgtggagagatgagggactggtgctactcaatcgactcagatatcgg
cccattaacagcagatcctggaatatggttaatgtcacaaatgccaaaggaagacatgac
ttgctggatctgaaaccctttacagaatatgaatttcagatttcctctaagctacatctt
tataaaggtagttggagtgattggagtgaatctttgcgaacacaaacaccagaagaagag
cctattgggatgttaaatgtctggtacatgagacagcacattgactacaatagacaacag
atttctcttttctggaagaatctgagtctatcggaagcaagaggaaaaatcctccactat
caagtgaccttgcagaaggtggcaggaggggaaatcacactacagaacatcacagaacac
acttcctggacctgggtaattcccagaactgggaactgggctgcggctgtgtctgcagct
aactcgaaaggcagttccctgcccactcgcattaacataacggatctgtgtggggcagag
ttgctggctcctcaacaggtcttggcaaagtcagagggcatggacaagctcatggtgacg
tggacacctccagagaaagctaccgctgctgtgcaggaatacgtggtggagtggagggag
ctccacccaggggctggtatgcagccccctcttggctggttgtggagtcccccctacaga
ctgtctgctctgatttcagaaaacataaaaccctacatctgttatgaaatccgcgtgcat
gcacttgcaggggaccagggaggatgcaactccacccggggtaactcccagcacaaagca
ccactgagtggcccccacattaatgccatctcagaggaaaaggggagcgttttaatttca
tgggatgaaattccagcccgggagcaaatgggctgcatcctccactacaggatatattgg
aaggaacgggactccaactcccagcctcagctttgtgaaattccctataggatctcccca
aattcacatcccatagacagcctgcagcccagagtgacatatgttctgtggatgacagct
ctgacagctgctggtgaaagcccccaaggaaatgaaagagaattttgtctgcaaggcaaa
gccaattggagcacatttgtggcaccaagtatctgcatggctgtcatcatggtgggcgtt
ctctcaatgcgttgcttccgacaaaaggtatttgttctccttttggccctcagacctcag
tggtgtagcaaagaaattccagatccagcaaacagcacttgggccaagaaatatcctatt
gtggaggaaaagacacagctggccttggataggctcctgacagagtggcccactcctgaa
gaacctgagccgctggttatcaacgaagtcctttgtcgagtgacaccagtcttcagacct
ccccatcaccgcagctggtcagaaaagggacaaggagtccaaggtcactatacctctgag
gaagacacagggtacagtgcctcaagcccaccacctccaagggctcccacagcagagaca
ggacaaggggtggatctatacaaggttctaggaagcaagggccctgactcaaagccaggg
aacccagccagccccttgaccatcctcccagtggactaccttcctacccatgatggctac
ttaccctccaacatggattatctcccttcacatgaggctcccataactgatcctctggaa
gaactgcctcaacacatctctctttccattttcccctcaagttcccttcgcccactcacc
ttctcctgtggtgagaagttgactctggaccagttaaagatggggtgtggctccctcatg
ctctga

KEGG   Bos indicus (zebu cattle): 109556180
Entry
109556180         CDS       T04792                                 

Gene name
IL23R
Definition
(RefSeq) interleukin-23 receptor isoform X1
  KO
K05065  interleukin 23 receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04659  Th17 cell differentiation
biu05200  Pathways in cancer
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109556180 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109556180 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109556180 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109556180 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109556180 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109556180 (IL23R)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL6/12 receptor family
   109556180 (IL23R)
SSDB
Motif
Pfam: IL6Ra-bind fn3 Lep_receptor_Ig IL12p40_C PriX
Other DBs
NCBI-GeneID: 109556180
NCBI-ProteinID: XP_019812858
UniProt: A0A6P5B2Q8
LinkDB
Position
3
AA seq 630 aa
MNQVTIHWDVVIALYIFFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PSKLYFYKNGIKERFHITRINKTTARLWYNNFVEPQAFVYCTAECSRYFPETLICGKDIS
SGYPPDVPDKVACVIYEYSGNMTCTWNPGRPTYIDTKYVVYVKSLETEEEQEYLTSSYIN
ISTDSLQKGKKYLVWVQASNVLGMEKSKQLQIHLDDIVIPSASIISRAEDINTTVSKTVI
HWDSQTSIEKVSCEMRYKDTTNQTWNVKEFDTNFTYEQQSEFYLQPNAMYVFQVRCQETG
KKYWQPWSSPFFHKTPEIVPQVTMKSFQHDTQNSGLLIASIFKKHLTSDNRKQDXGLLLG
MVFFAVMLSVLSLIGIFNRSLRTGIKRRILLLIPKWLYEDIPNMENSKVVKILQERNEFM
NNNSSEQVLYVDPVITEIEIILPEEKPMGYKKENNTGCLERKESLEKSLLTDTTVVYIPD
LNTGYKPQISSFLPGGNHLSNDDETASSILEPPADSLNLGNNARFKKYPDFAFSVSSTNS
LSNTLFLEELNLILNQGECSPPDMQNSIEGETAMLLEDALLNETIPEQTLLPDEFVSCLG
SMNKELPSINSYFPQNILESHFNRISLLEK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgaatcaggtcacaattcattgggacgtggtaatagctctctacatattcttcagttgg
tgtcatggagggattacaaatataaactgctctggacacatctgggtagaacctgccaca
atttttaagatgggtatgaatatctctatatattgccaagcagcaattaagaactgccaa
ccaagtaaactttatttttataaaaatggcatcaaagaaagatttcatatcacaagaatc
aataaaacaacagctcgcctttggtataacaactttgtggagccacaagcctttgtgtac
tgtactgctgaatgttccagatattttccagagacactgatatgtggaaaagacatttct
tctggatacccaccagatgtacctgacaaagtagcctgtgtcatttatgaatattctggc
aacatgacttgtacctggaaccctgggaggcccacctacatagacacaaagtatgtggtg
tacgtgaagagtttagagacagaagaagagcaagaatatctcacttcaagttacattaac
atctccactgattcattgcaaaagggcaagaagtatttggtttgggtccaagcttcaaat
gttctgggcatggagaagtcgaaacaactacaaattcatctggacgatatagtgatacct
tctgcatccattatttccagggctgaggatataaatactacagtgtccaagactgtaatc
cactgggatagtcaaacatcaattgaaaaagtttcctgtgaaatgagatacaaagataca
acaaaccaaacttggaacgttaaagaatttgataccaattttacatacgagcaacagtca
gaattctacttgcagccaaatgctatgtatgtatttcaagtgagatgtcaagaaacaggt
aaaaagtactggcagccctggagttcacccttttttcataaaactcctgaaatagttcct
caggtcacaatgaaatcattccaacatgatactcagaattctggacttctaattgcttcc
atctttaaaaaacaccttacttctgacaacaggaaacaagacaytggacttttattggga
atggtcttctttgctgttatgctgtcagttctatctttgattgggatatttaacagatcg
cttcgaactggaattaaaagaagaatcttattgctaataccaaaatggctctatgaagat
attcctaatatggaaaacagtaaagttgtgaaaatmcttcaggaaagaaatgagtttatg
aataacaattccagcgaacaggtcctatatgttgatccggtgattacagagatagaaatc
attctcccagaagaaaaacccatgggctacaagaaagaaaacaatacaggatgcctggag
agaaaagagagcctggagaaatcactactcaccgacactacagttgtttatattcctgat
ctcaacactgggtataaaccccagatttcaagttttctccctgggggaaaccatctcagc
aatgatgatgaaacagcttcctcaattctggaaccaccagctgattccttaaacttggga
aacaatgccaggtttaaaaaatatcctgattttgctttttctgtctcaagtacaaattca
ctaagcaacacactatttcttgaagaattaaacctcattttaaatcaaggagaatgcagt
cctccggacatgcaaaactcaatagagggggaaactgccatgcttctggaagatgcatta
ctgaatgaaactattccagaacaaactctgctgcctgatgaatttgtctcctgtttgggg
agcatgaacaaagagttgccatctattaattcttactttccacaaaatattttggaaagc
cacttcaatcggatttcactcttagaaaagtag

KEGG   Bos indicus (zebu cattle): 109556197
Entry
109556197         CDS       T04792                                 

Gene name
LEPR
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04152  AMPK signaling pathway
biu04630  JAK-STAT signaling pathway
biu04920  Adipocytokine signaling pathway
biu04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109556197 (LEPR)
   04152 AMPK signaling pathway
    109556197 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109556197 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    109556197 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109556197 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109556197 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109556197 (LEPR)
   04090 CD molecules [BR:biu04090]
    109556197 (LEPR)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  Prolactin receptor family
   109556197 (LEPR)
CD molecules [BR:biu04090]
 Proteins
  109556197 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 109556197
NCBI-ProteinID: XP_019812874
UniProt: A0A6P5BP38
LinkDB
Position
3
AA seq 1165 aa
MICQKFCVALLHWEFIYVITAFNLAYPITPWKFKLSCMPSNTTYDFLFPPGISKNTSNLN
GRYEAVVETKLNSSGTYLSNLSSRTTFHCCFWSEEDKNCSVYTDDIEGKAFVTTVNSLVF
QQTGANWNIQCWMKEDLKLFICNIESLFKNPFKNYDLKVHLLYVLLDVLEESPLLPQKDS
FQVVQCNCSVHECCECHVPVPTAKLNDTLLMYLKITSGGAVFHSPPMSAQPINVVKPDPP
LGLRMEITDTGSLKISWSSPTLVPFQLQYQVQYSENSTKYIRKTDEIVSATSLLVDSVLP
GSSYGAQVRCKRLDGLGIWSDWSALLTFTTQDVIYFPPKILTAVGSNISFHCIYKNEKKI
VSSKKIVWWLNLAEKIPQSQYDVVDDHISKVTFPNLNATKPRGKFTYDAVYCCNEQECHH
RYAELYVIDVNINISCETDGYLTKMTCRWSPNAIQSLAGSNLQLRYHRSSLYCSDVPSIH
PVSEPKDCHLQRDGFYECIFQPIFLLSGYTMWIRINHTLGSLDSPPACVIPDSVVKPLPP
SSVKAEITVKIGLLKISWEKPVFPENNLQFQIRYGLSGKQVQWKMFEVYDAKLKSASLPV
PDLCAVYTVQVRCKRLDGLGYWSNWSTPAHTVVMDVKVPIRGPEFWRLISEDTTKKERNV
TLLWKPLMKNDSLCSVRRYVVKHHTSHNGTWLEDVGNHTKLTFLWTEQAHSVMVLAINSI
GASSANFNLTFSXXISKVNIVQSLSAYPLNSSCVILSWMLSPSDYNLMYFILEWKILNED
SEIKWLRIPSSVKKYYVHDYFIPIEKYQFSLYPIFTEGVGKPKIINSFAQDDEKHQHDAD
LYVIVPIIISSSILLLGILSVSHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFIK
HTESTTFGPLLLEPETISEDISVDTSWKNKDEMVPATTDALLLMTPDLEKGSICISDQCS
SAQFSEAESTDITCEDESRRQPSVKYATLLSNSKSGETEEEQGLINSSVSKCFLSNNSPP
KDSSSKRSWEIETQAFFILSDQHPNIISPHLPFSEGLDELLKLEGNFPEENNNERPVYYL
GVTSIKKRESDVFLTNESRVLSPFPAHCLFTDIRILQDSCSHLVENNFNLGTSGQKTFVS
YMPQFQTCSTQTQKIMENKMCDLTV
NT seq 3498 nt   +upstreamnt  +downstreamnt
atgatttgtcaaaaattctgtgtggctttgttacattgggaatttatttatgtaataact
gcatttaacttggcatatccaattactccctggaaatttaagttgtcttgcatgccatca
aatacaacatatgacttcctctttcctcctggaatctcaaagaacacttcaaatttgaat
ggacgttatgaggcagttgttgaaactaagcttaattcaagtggtacctacttatctaac
ttatcatccagaacaactttccactgttgcttttggagcgaggaagataaaaactgctct
gtatatacagatgacattgaagggaaggcatttgttacaacagtaaattctttagttttt
cagcaaacaggtgcaaactggaacatacagtgctggatgaaagaggacttgaaattattc
atctgtaatattgagtcattatttaagaatcctttcaagaattatgaccttaaggtccat
cttttatatgttctgcttgacgtgttagaagagtcacctctgctcccccagaaagacagt
tttcaggttgttcagtgcaactgcagtgttcatgaatgttgtgaatgtcatgtgcctgtg
ccgacagccaagctcaatgacacccttcttatgtatttgaaaatcacatctggtggagca
gtttttcactcacctccaatgtcagctcagcccattaatgttgtgaagcctgatccacca
ttaggtttgcgtatggaaatcacagacactggtagtttaaagatttcgtggtccagccca
acactggtaccatttcaacttcaatatcaagtgcaatattcagagaattctacaaaatat
ataagaaaaactgatgagattgtctcagctacgtctctgctagtagacagtgtgcttcct
gggtcttcgtatggcgcacaggtgaggtgcaagagattggatggcctaggaatctggagt
gattggagtgcccttcttacctttactacacaagatgtcatatattttccacctaaaatt
ctgacagckgttgggtctaacatttcttttcactgtatctataaaaatgaaaagaagatc
gtttcctcaaaaaagattgtttggtggttgaatttagctgagaaaattcctcaaagccag
tatgatgttgtggatgaccatattagcaaagttacttttcccaacttgaatgcaaccaaa
ccccgaggaaagttcacctatgatgcagtgtactgctgcaatgagcaagagtgccaccat
cgctatgctgagttatatgtgattgatgtcaatatcaatatatcatgtgaaactgatggg
tacttaactaaaatgacttgcagatggtcacccaatgcaatccaatcacttgcaggaagc
aatttgcagctgaggtatcataggagcagcctgtactgttctgatgttccgtctattcat
cctgtatctgaacccaaagattgccacttgcagagagatggtttttatgaatgcatattt
cagccaatctttctattatctggctatacaatgtggattagaattaatcacacgttgggc
tcactggactctccaccagcttgtgtcattcctgattctgtggtgaaaccactgcctcca
tccagtgtgaaagcagaaattactgtaaaaattggattattgaaaatatcttgggaaaag
ccagtcttcccagagaataatcttcagttccagattcgctatggtttaagtggaaaacaa
gtacaatggaagatgtttgaggtatatgatgcaaaattaaaatctgccagtctcccagtg
ccagacctctgtgcagtctatactgtccaggtgcgctgtaagaggctagatggactggga
tattggagtaattggagtactccagcccacacagttgtcatggatgtgaaagttcctatc
agaggacctgaattttggagactaattagtgaagacaccactaaaaaagagagaaatgtc
actttgctttggaagcccctgatgaaaaatgactcattgtgcagtgtaagaagatatgtg
gtaaaacatcatacttcccacaatggaacgtggttggaagatgtgggaaaccacactaaa
ctcactttcctttggacagagcaagcacattctgttatggtgctggccatcaattcaatt
ggtgcttcttctgcaaattttaatttaacattctcannnnntatcagcaaagtaaatatc
gtgcagtcactcagtgcttaccctttaaacagcagttgtgtaattctttcctggatgctg
tcacccagcgattacaatctgatgtattttattcttgagtggaaaattcttaatgaagac
agtgaaattaaatggcttagaatcccttcctctgttaagaagtattatgtccatgattat
tttatccccattgagaaatatcagttcagtctttacccaatatttacggaaggagtaggg
aaaccgaagataattaatagttttgctcaagatgatgaaaaacaccagcatgatgcagat
ctatatgtaatcgtgccaataataatttcctcctcaatcttattgcttggaatattgtca
gtgtcacatcaaagaatgaaaaagttgttttgggaagatgttccaaaccccaagaactgt
tcctgggcacaaggacttaattttcagaagccagaaacatttgagcatctttttatcaag
catacagaatcaacgacctttggtcctcttcttttggagcctgaaaccatttcagaagat
atcagtgttgatacatcatggaaaaataaagatgagatggtgccagcaactacagatgct
ctacttttgatgactccagatcttgaaaagggttctatttgtattagtgaccaatgcagc
agtgctcaattctctgaggctgagagcacagacataacctgtgaggatgagagcaggaga
cagccctctgttaaatatgccaccctgctcagcaactctaaatcaggtgaaactgaggag
gagcaaggacttataaatagctcagtcagcaaatgctttttgagcaacaattctccacca
aaggattcttcctctaagagatcatgggaaatagaaacccaggcattttttatattgtca
gatcaacatcccaatataatttcaccacaccttccgttctcagaaggcctggatgaactt
ttgaaacttgagggaaatttccctgaggaaaataataatgaaaggcctgtctattattta
ggagtcacttcaatcaaaaagagagagagtgatgtgtttttgaccaatgagtcaagagtg
ttgtccccattcccagcccactgtttattcactgacatcagaatcctccaggacagttgc
tcacaccttgtagaaaataacttcaacttaggaacttctggtcagaagacttttgtatct
tacatgcctcaatttcagacttgttccactcagactcagaaaataatggaaaacaagatg
tgtgacctaactgtttaa

KEGG   Bos indicus (zebu cattle): 109556495
Entry
109556495         CDS       T04792                                 

Gene name
CSF3R
Definition
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109556495 (CSF3R)
   04151 PI3K-Akt signaling pathway
    109556495 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109556495 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109556495 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109556495 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109556495 (CSF3R)
   04090 CD molecules [BR:biu04090]
    109556495 (CSF3R)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  Prolactin receptor family
   109556495 (CSF3R)
CD molecules [BR:biu04090]
 Proteins
  109556495 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind Pur_ac_phosph_N IL6Ra-bind Tissue_fac ObR_Ig
Other DBs
NCBI-GeneID: 109556495
NCBI-ProteinID: XP_019813379
UniProt: A0A6P5BPN9
LinkDB
Position
3
AA seq 841 aa
MVGLGAWSLVGAALIILLLPRSLEQCGHILLSAPIVRLGDQVTASCIINRNCSHLGTDWR
VVWKLEPELHPRERRQHLPNGTLQSTITLPHLNHSRVLLSCCLHWGNSLQILDQAELQAG
YPPTAPYNLSCIMNLTTNSLICQWEPGPNTHLSTSFTLKSFKSQDKCQTQKDSIPDCVPE
VGQSHCSIPRKHLQLYQNMSIWVQARNALGTSASPKLCLAPMDVVKLEPPTLWALEPSPA
VAPPQPGCLRLRWETWRPSLYIEQKCELRHQPRLREAGWDLVSALPARTSQYELCGLLPS
TAYTLQMRCTRWRLPGHWSEWSPSLELTTAQRAPIVRLDTWWRQRQLDPETVTVQLFWKP
IALEEDSGQIQGYLVSWRPSDQAGAEPTLCDTTELNCTFQLPSEAREVVLKAYNTAGTSH
PTPVVFLESRGPPLGRLHTTARDPHSLWVGWEPPSPQPQGYVIEWGLSPPSPNGSPMTWR
MEHNGSIAGTLLQENIRPFQLYEITVTPLYQDTKGPSQHIYAYSQEMAPSHGPELHLRHI
GKTWAQLEWVPEAPELGKSPLTHYTIFWTNTQDQSFSTVLNASTHSFVLRGLEPSSLYHV
QLMAASQVWAANSTSLTLMTLTLEESELHILLGLFGLLVLLICLCGAAQFCCRPSRKYSL
WPSVPDPARSSLGSWVPTITAEDILQLPSLRDPGMPPITKITVLEEEEKKPGPWESNASS
GPGSLSTLVQAYVLQGDPRVPSAQPQPQPGNSDQVLYVQVLGSPTGPGPGHYLRCDSTQP
LLEGLSPSPKSYENLWFQXSSPGTPEPLVPHPEDDSIFEPLLDFPLLQGLRVSGAEGLGG
F
NT seq 2526 nt   +upstreamnt  +downstreamnt
atggtggggctgggagcctggagcctggtgggagctgctctgatcatcctcctgctcccc
agaagcctggagcagtgtgggcatatcctcctctcagcccccatcgtccgcctgggagat
caagtcacggcctcctgcatcatcaaccggaactgcagccacctgggcaccgactggcga
gttgtatggaaactggaaccggagcttcatcccagggagaggcggcagcacctgccgaac
gggaccctgcagtccaccatcaccttgccccacctcaaccactctcgggtccttctctcc
tgctgcctgcactggggcaacagcctgcagatcctggaccaggctgagctacaggcgggc
taccctcccactgcaccctacaacctatcctgcatcatgaacctcacaaccaacagcctc
atctgtcagtgggagccaggccccaacacccacctgtccaccagcttcaccctgaagagc
ttcaagagccaggacaaatgccagacgcagaaggattccatccctgactgcgtgccggaa
gtcgggcagagccactgctccatcccccgcaaacacctgcagctgtaccagaacatgagc
atctgggtgcaggccaggaacgcgctggggaccagcgcttccccaaagctctgcctggct
cccatggacgttgtgaaactggagccccccacactgtgggccctggagcccagccctgcg
gtggccccgcctcagccaggctgcctgaggctgcgctgggagacctggaggccaagtctg
tacatagaacagaagtgtgagctgcgccaccagcctcggcttagagaagccggctgggac
ctggtgagcgccctgcccgccaggacctcccagtatgaactctgcgggctcctcccatcc
acagcctacaccctgcaaatgcgctgcacccgctggcgcctgcccggccactggagcgaa
tggagccccagcctggagctgaccaccgcacaacgggcccccatcgtcagactggacacg
tggtggcggcagaggcagctggaccccgagacggtgaccgtgcagctgttctggaagcca
atagccctggaagaagacagcggacagatccaaggttacctggtttcctggagaccctca
gaccaggctggggcagagccaaccctctgtgacaccacggagctgaactgtaccttccaa
ctgccttcagaagcccgggaggtggtccttaaggcctataacacagctgggacctcgcat
cccacccccgtggttttcttggaaagcagaggcccacccctgggcagactccacaccacc
gctcgagaccctcatagcctctgggtgggctgggagccccccagtcctcaacctcagggc
tatgtgattgagtggggcctcagtccccccagccccaacggcagtcctatgacctggagg
atggagcataayggaagcattgcagggaccttgctgcaggagaacatcaggccctttcag
ctctacgagatcactgtgacccccctgtaccaggacaccaagggaccctcccagcatatc
tatgcctactcccaagagatggccccctcccatggcccagagttgcatctcaggcacatt
ggcaagacgtgggcccagctggagtgggtgcctgaggcccctgagctggggaagagcccc
cttacccactacaccatcttctggaccaacactcaggaccagtccttctccactgtcctg
aatgcctccacccacagctttgtcctccgtggcctggagccttctagcttgtaccatgtc
caactcatggccgccagccaggtgtgggccgccaacagcacaagcctcaccctgatgacc
ttgactctagaggagtctgagctgcacatcctcctgggcctgttcggcctcctggtcttg
ctcatctgcctctgtggggctgcccagttctgctgcagacccagcaggaagtattccctc
tggccgagtgtcccggacccagcccgcagcagcctgggttcctgggtgccaaccatcacr
gcggaggatatcttacagctgcccagccttcgggaccccggcatgccacccatcaccaag
atcacggtgctggaggaggaagagaagaagccagggccctgggagtccaatgccagctca
gggcccggtagcctctccacccttgtccaggcctatgtgctccagggggacccaagagtg
ccctccgctcagcctcagccccagcctggcaacagcgaccaggtgctttacgtgcaggtg
ctgggcagccccacgggcccagggcctgggcactacctccgctgcgactcaactcagccc
ctcttggagggcctctcccccagtcccaagtcctacgagaacctctggttccagrccagc
tctccggggaccccagagcccctagtcccacatccggaggacgacagtatctttgagcct
ctgcttgacttccctctactacaaggactccgggtcagtggggcggagggtcttgggggc
ttctag

KEGG   Bos indicus (zebu cattle): 109557096
Entry
109557096         CDS       T04792                                 

Gene name
MPL
Definition
(RefSeq) thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109557096 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109557096 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109557096 (MPL)
   04090 CD molecules [BR:biu04090]
    109557096 (MPL)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  Prolactin receptor family
   109557096 (MPL)
CD molecules [BR:biu04090]
 Proteins
  109557096 (MPL)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind ObR_Ig Tissue_fac
Other DBs
NCBI-GeneID: 109557096
NCBI-ProteinID: XP_019813987
UniProt: A0A6P5BJL8
LinkDB
Position
3
AA seq 644 aa
MPSWALLAVISYLLPVPQYLAQVTSQDVSSLASDSESLNCFSRTFEDLTCFWDEEEGAPS
EMYQLLYAYPGEQPRTCPLSSQHVMPFRTRYVCQFPAQAEVRLFSQLHLWVKNVFLNQNL
TQRVLSVDAVGLPTPPSXIKAMGGSQPGELQISWEAPAPEINEFLRHELRYGPKDPRNSS
GATVTQLLSAETCCPARRRPNLAAALDPSPCSQPMMPQQTGPEQTSPTREAPSLTTKGGS
CLISGLQPGNSYWLQLRSQPDGVSLRGSWGSWSLPVTVDLPGDAGEIGLQCFTLDLTNVT
CQWQQQDHASSQGFFYHSRARCCPRDRDPVWEKCEEEKNSGSQSSQFSRCHFKSQNNSAI
HILVEVTTAQGAVHSYLGSPFWIHQAVLIPTPNLHWREVSSGQLELEWQHPSAWAAQETC
YQLRYTAEGHQDWKVLEPPLGAQGETLELRPRSRYRVQLRARLHGPTFQGPWSSWSDPVR
VETASETVWIFLVTALLLVLSVSALLGLLLLRWQFPEHYRSLRHALWPSLPDLHRVLGQY
LRDTAALSPPKAAVSDVYEEVEPSLLEILPRSSEKAPLPLCSSQAQLDYRGLQPSCLGTM
PLSVCPPMAEPGSYCATHIANHSYLPLSCWQVPRSQYPGQIQTL
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgccctcctgggccctcttggcggtcatctcctacctcctcccggtcccccaatacctg
gcacaagtcaccagccaagatgtctcctcgctggcctcggactcagagtccctgaactgt
ttctctcgaacctttgaggacctcacttgcttctgggatgaggaagagggagcgcccagt
gaaatgtatcagctgctgtatgcctatccgggggagcagccccgcacctgccccctgagt
tcccagcatgtgatgccctttagaacccgctacgtgtgccagtttccggcccaggctgaa
gttcgcctcttctctcaactgcacctctgggtgaagaacgtgtttctgaaccagaatctg
acccagcgggtgctctctgtggatgccgtgggyctgccaactccccccagtytcatcaag
gccatgggtgggagccagccaggggaacttcagatcagctgggaggccccagctcccgaa
atcaatgaatttctgaggcatgaactccgctatggccccaaggaccccaggaactccagt
ggcgccacagtcacacagctgctgtctgcagaaacctgctgcccagctcggcggaggcca
aacctagcggcagccctggacccgtctccatgttcacagcccatgatgcctcaacagact
ggaccggagcagacctccccaactagagaggctccatctctgacaacgaagggtggcagc
tgcctcatctcaggactccagcctggtaactcctactggctccagctacgcagccaacct
gatggggtctctctccgtggttcctggggatcttggtccctcccagtgactgtggacctg
cctggtgatgcaggggaaattggactacaatgctttaccttggacctgacgaatgttacc
tgtcagtggcaacaacaggaccatgccagctcccaaggtttcttctaccacagcagggca
cggtgctgccccagagacagggaccccgtctgggagaagtgtgaagaggagaaaaactca
ggatcacagtcctcccagttctcccgctgccacttcaagtcacaaaataacagtgctatt
cacatccttgtggaggtgaccacagcccagggtgctgttcacagctacctgggctcccct
ttctggatccaccaggctgtgctcatccctactccaaacttgcactggagggaggtctcc
agcgggcagctggaactggaatggcagcatccatcagcctgggcagcccaagaaacctgc
tatcagctccgatacacagcagaaggccatcaggactggaaggtgctggagccacctctt
ggggctcagggagagaccttggagttgcgcccgcgctcccgctaccgcgtacagctgcgc
gccaggctccacggccccaccttccaaggtccctggagctcttggtccgacccagtgagg
gtggagacggcctcggagacggtctggatcttcctggtgactgctctgctcctggtcctg
agcgtcagcgccctcctgggcctgctgctgctgaggtggcaatttcctgagcactacagg
agcctgaggcatgccctgtggccctcacttccagacctacaccgggtccttggccagtac
cttagggatactgcagccctgagtccgcccaaggctgcagtctcagatgtctatgaggaa
gtggaacccagcctccttgaaattctacctagatcctcagagaaggctcccttgcccctg
tgttcctcccaggcccaaytggactaycgaggattgcagccttcttgcctggggaccatg
cccctgtctgtgtgcccaccaatggctgagccagggtcctactgtgccactcacatcgcc
aaccattcctacttaccactcagctgctggcaggtccctcgctcccagtaccctggacag
atccaaactctctag

KEGG   Bos indicus (zebu cattle): 109559524
Entry
109559524         CDS       T04792                                 

Gene name
CSF2RB
Definition
(RefSeq) cytokine receptor common subunit beta
  KO
K04738  cytokine receptor common subunit beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04210  Apoptosis
biu04630  JAK-STAT signaling pathway
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109559524 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109559524 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109559524 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559524 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109559524 (CSF2RB)
   04090 CD molecules [BR:biu04090]
    109559524 (CSF2RB)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL3 receptor family
   109559524 (CSF2RB)
CD molecules [BR:biu04090]
 Proteins
  109559524 (CSF2RB)
SSDB
Motif
Pfam: IL6Ra-bind fn3 IL4Ra_N EpoR_lig-bind IL2RB_N1 Tissue_fac
Other DBs
NCBI-GeneID: 109559524
NCBI-ProteinID: XP_019816890
UniProt: A0A6P5BUI5
LinkDB
Position
5
AA seq 890 aa
MTLTQGLLPLALLXLCWGLSITGAEETVPMQTLRCHNDYTSRIICRWADTQDAQRLVNVT
LYRRPKEDHPQRVSCXLSDDKPWLNSPCPGCVPRKCVIPYRNFVLADFDYFSFRPDQPLV
TELTVNLSQHVQPPTPKDLNITATRESLLLFWSIAHXGFQSHWLSSLEFEVVYKRLQDSW
EDALTIHSKSPQAILELKDLQPSSTYVARVRTRLAPGSGLSGRPSQWSQEVSWNSQPGDE
AQPQNLQCFFDGATLLTCTWEVRSEVTHSVSFTLFYKTGPSAREEECSPVQKETGSPYIQ
HRCQIPVPDPRNYSQYIVSVRPKVEERLIKSSDNIQMAPPTLNVTKGRDGYILHWREEKM
SYSHIACIFQVQYKKEGASWEDTKTEDFQNAHTMSLPPLEPASRYQARVRVKPDPGNYNG
IWSEWSEARSWDTDWVLPMWVLALILVISTLILLPVLHFCGVYGYRLNRKWEEKIPNPSK
SHLFQNGSAGLRMPDSMATLGXGSHPHKGPWGSSCPQLLEGVFPVDCRHSEVSPLTTEDP
KDACDSSSEPDMTLTASDLPTEQPPSPPTGLAAPSSRPESQASGFDFNGPYLGPPHSCSL
PDLMGQQVPPQTGVSRKPQSPGSLEYLCLPAGGQVQLVPLAQVKRQGKAGDGDTKSSPGA
QTSPSLESGVDPAPPEPGLMGVGQDQKDRAPTVLPTGLPEDGTVASGYVTTPDLIFTPPI
GAPSPSQAAPPNLPSDQNPTFHPGLADGPPVASAPQKPEFEGYVELPPATGQFPQSPLAS
PAPPRVSSPVLSPGPHRADVSPTSPTPEGLLVLQQVGDYCFLPGPLSPQSKPTSPGPCPE
IRDLNQVVQAKKPPAQAFPQVPAIQLFKALKQQDYLSLPPWDINRPGQVC
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgacactgacccaggggctgctccccctggctctgctggygctctgctggggactcagc
ataacaggggctgaagagactgtcccgatgcagaccctgcgctgccataatgactacacc
agccgcatcatctgcaggtgggcggacacccaggatgcccagcgactggtcaacgtgacc
ctctaccgcaggcccaaggaggaccatccacagcgagtgtcctgcartcttagtgacgac
aagccctggttaaacagcccttgtcctggctgcgtacccagaaaatgtgttattccttac
cgaaactttgtccttgccgactttgactacttctcattccgaccggaccagcctctggtc
actgagctcaccgttaatctgagtcagcatgtgcagccccccacacccaaggacctcaac
atcactgctaccagggagagtctcctgctgttctggagcatagcccatgasggtttccag
agccactggctgtccagcctggagtttgaggtggtctacaagcggcttcaggactcctgg
gaggatgccctcaccatccactccaagtccccccaggccatcttggagctgaaggacctt
cagcccagcagcacctacgtggcccgagtgcgcaccaggctggccccaggctcggggctc
tcaggacgacccagccagtggagccaggaggtttcctggaactcccagccaggggatgag
gcccagcctcagaacctccagtgcttctttgacggggccaccctgcttacctgcacctgg
gaagtgaggtccgaggtaacccactccgtctccttcaccctcttctacaagacyggcccc
agtgcacgggaggaagaatgctctcccgtgcagaaggagactggcagcccctacatccag
caccgatgccagattcctgtgcctgaccccaggaactacagccagtacatcgtctctgtt
cgaccaaaggtggaagagagacttataaagagctcagacaacatccagatggctccccca
accctcaacgtgaccaagggcagagatggctacatcctgcactggagagaagaaaaaatg
agctactcacacatagcttgcatcttccaggtccagtacaagaaagaaggagcctcatgg
gaggacaccaagacagaggacttccagaatgcccacaccatgtcgctgccacctctggag
cccgccagccggtaccaggccagagtgagagtcaaacccgacccggggaactacaatggg
atctggagcgaatggagtgaagcaaggtcctgggacaccgattgggtgctgcccatgtgg
gtcctagccctcatcctcgtcatcagcaccttaatcctgcttccagtcctgcacttctgt
ggcgtctacgggtacaggctgaaccggaaatgggaggagaaaatccctaaccccagcaag
agccacctgttccagaatgggagcgcyggactccggatgccagacagcatggccaccctg
ggcartgggagccacccacacaaggggccgtggggcagcagttgccctcagctcctggag
ggggtgttccctgtagactgcaggcacagcgaggtgtcacctctcaccacagaggaccct
aaagatgcctgtgactcatcatcagagccggacatgactctgactgcctcggatctcccc
acggagcagccccccagccccccgacagggctggctgccccctcaagcaggcctgagagc
caggcttccggctttgacttcaacggtccctatctggggccgccccacagctgctccctg
cctgacctcatgggccagcaggtgcccccacagacgggggtgagcaggaagccacagtcc
ccggggtccctggagtacctgtgtctgcccgcaggggggcaggtgcagctggtcccgctg
gcccaggtgaagaggcagggcaaggccggggatggggacacaaagtccagcccaggggcc
cagacgagcccttccctggagtcaggggtggaccctgcccctccagagcctgggctgatg
ggggttggtcaagatcagaaggacagggcccccacagttctgcccactggcttgcctgag
gatggcaccgtagcctctggttatgtcaccaccccagatctgatattcaccccacccatc
ggggccccatctccctcccaggctgcccctccaaacctcccctcagaccagaaccccact
ttccatcctggactggctgatgggccccctgtagcctcagccccccagaaaccagagttc
gagggctatgtggagctccctccagccacaggccagtttccccagtcccctctagccagc
cctgcccctcccagagtcagcagccctgtcctgagcccaggcccgcaccgggcagatgtg
tcccccacctcccctacccctgagggtctccttgtcctgcagcaggtgggtgactactgc
ttccttcctggccctctctccccccagagtaagcccacttccccaggaccctgtcctgag
atcagggacctcaaccaggtggtccaggctaagaagcctccggctcaggcctttccccag
gtgcctgccattcagctcttcaaagccctgaaacagcaggactacttgtcactgccccct
tgggacattaacaggcctgggcaggtgtgctga

KEGG   Bos indicus (zebu cattle): 109559534
Entry
109559534         CDS       T04792                                 

Gene name
IL2RB
Definition
(RefSeq) interleukin-2 receptor subunit beta
  KO
K05069  interleukin 2 receptor beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04144  Endocytosis
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109559534 (IL2RB)
   04151 PI3K-Akt signaling pathway
    109559534 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109559534 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109559534 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109559534 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109559534 (IL2RB)
   04659 Th17 cell differentiation
    109559534 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559534 (IL2RB)
   05202 Transcriptional misregulation in cancer
    109559534 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109559534 (IL2RB)
   05162 Measles
    109559534 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109559534 (IL2RB)
   04090 CD molecules [BR:biu04090]
    109559534 (IL2RB)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL2 receptor family
   109559534 (IL2RB)
CD molecules [BR:biu04090]
 Proteins
  109559534 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 109559534
NCBI-ProteinID: XP_019816906
UniProt: A0A6P5BUJ1
LinkDB
Position
5
AA seq 540 aa
MRRKGEMLTKGSRAGGVGIKPGLRTVXLHGHPPEASSEGVPLFLQREXLFPTKQWNHTCE
LQPVRPGSWACNLVLGHSPEAQKLTXVDVMKLTVMCSEGGKWRRMMTQDIKPFDYIRLVP
PHSLQVVXIETHRCNITWTVSQVSHYIQNDVEFEARLRYADHSWEDARLLTLRQNQQWIS
LENLAPGMEYELQVRAKPRLGSHEVWSHWSQPLAFRTVPAETKKKIPPLPWLNHIFLGVG
SFFGLVLLVYFLGSFRCIRLWLKNVLKCHIPDPSEFFSQLSSEHGGDFQKWLSSPFPSSS
FSRSGLDPEISPLEVLDRDAKATQLLLLQQDKGSSSSAETSGHSVTSCFTNQGYFFFHLP
DALEIEACQVYFAYDPCXEELDEGGPRAPEGALLPPLPTPPGDDDAYCTFPPGEDLLLFS
PSLLSGPGPPNTAQWGTGAGEERLASSPQEGVPGDWTPQPLRPPALEAPDLVDLQSSPEH
ELGEARERVPGPSPREGTSFPWASPPGQGQVRAPTVCLTLNTDAYLSLQELQDQDPAYLV
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgaggaggaagggagagatgctcacaaagggaagcagggcaggtggggttggcataaar
cccgggcttaggacagtaaygctgcatgggcaccctcctgaggccagctctgagggggtc
cctctttttcttcaaagagagstgctttttcctacaaaacagtggaaccacacctgtgag
ctgcagccagtgaggccaggatcctgggcatgcaacctggtcctgggacattctccagaa
gctcagaaactgaccrtagtggatgtcatgaaattgacggtgatgtgctctgaaggcggg
aagtggaggaggatgatgacccaggatatcaagccctttgattacattcgtctggttcca
ccccactcactccaggtcgtccrcatagagacccataggtgcaacataacctggacygtc
tcccaggtatcccactacatccaaaacgacgtggagtttgaggcccggttaaggtacgcc
gaccacagctgggaggacgcccggctactgaccctcaggcagaaccagcaatggatctcc
ctggagaatctcgctccaggcatggaatatgagcttcaggtgcgggccaagccccggcta
ggcagccacgaggtttggagccactggagccagcccctggccttcaggacggtccctgca
gaaaccaagaagaagatcccacctctcccttggttgaaccacatcttcttgggcgttggc
agtttctttggtcttgtcctcttggtttactttctgggcagcttccggtgcatcaggcta
tggctgaagaatgttctcaagtgtcacatcccagacccctcggagtttttttcccaactg
agctctgagcatggaggagatttccagaagtggctctcttcacccttcccctcgtcctcc
ttcagccgcagtggcctggaccctgagatctccccactggaggtgttggacagggacgcc
aaggccacacagctgctcctgctgcagcaggacaagggctcgtcatcctcagctgagacc
agcggccactcggtgaccagctgcttcaccaaccaaggctacttcttcttccacctccca
gatgccctggagattgaggcctgccaggtgtacttcgcttacgacccctgcrcagaggag
cttgatgagggtgggcccagggcccccgagggagctctccttccacccctgccgactcca
ccaggggatgacgatgcctactgcaccttcccccccggggaagacctgctactcttctct
ccgagtctcctcagtggcccaggtcccccgaacactgcccagtggggcactggggctggt
gaagagaggctggcctccagcccacaggagggagtccctggagactggaccccccagccc
ctgaggcctcctgctctggaagcccctgacctggtggatctgcagtcatccccagagcat
garctgggagaagcaagagagagggtacctggtcccagtccaagggaggggaccagcttc
ccctgggccagccctcctgggcaaggccaagtcagggcccccactgtctgcctgaccctg
aacactgatgcctacttatccctccaagagctccaggatcaggacccagcttacttggta
tag

KEGG   Bos indicus (zebu cattle): 109560001
Entry
109560001         CDS       T04792                                 

Gene name
IL20RB
Definition
(RefSeq) interleukin-20 receptor subunit beta
  KO
K05137  interleukin 20 receptor beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109560001 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109560001 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109560001 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109560001 (IL20RB)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL10/28 receptor family
   109560001 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 LapA_dom DUF3805
Other DBs
NCBI-GeneID: 109560001
NCBI-ProteinID: XP_019817597
UniProt: A0A6P5BWZ6
LinkDB
Position
1
AA seq 305 aa
MVLEEIKTSLIMWFSYALIPCLFVDGVAVLPAPQNLSVQSTNMKHVLTWSPVTVPEEIVH
YSVEYQGEYESLYTSHIWIPSIWCSPTQRPECDITEDITATVSYSLRVRATLGSLTSTWS
TLKHRFNQNSTILTPPGMEITMDGFHLLIKLEDLGPHFEFFVSYWRREPGAKEHIKVVRP
GVLPVYLETVEPGAAYCVKARTFVKAIGRHSAFSPTECVKVQGEALPLALALFAFVGFML
ILVVALLSVWKMGRLLRHSCCPVVMLPDTLKITNSPQKLISCRKEEVEACVTSGLSSEEL
LKAWI
NT seq 918 nt   +upstreamnt  +downstreamnt
atggttctagaagaaatcaagacaagtcttatcatgtggttttcctacgccttgattcct
tgtttgtttgtggatggagtggctgttctacctgcccctcagaacctctctgtgcaatca
accaacatgaagcacgtcttgacatggagcccagtgactgtgcctgaagaaatagtacac
tattctgtcgagtaccagggggagtatgagagcctgtacacgagccacatctggatcccc
agcatctggtgctcacccactcaaaggcctgagtgtgacatcacagaggacatcaccgcc
actgtgtcgtacagcctccgggtcagggccaccctgggctcgctgacctcgacctggagc
actctgaagcaccgctttaaccagaactcaaccatcctcaccccgcctgggatggagatt
accatggacggcttccacctgcttattaagctggaagatctggggccccattttgagttc
ttcgtgtcctactggagaagggagcccggtgccaaggaacacatcaaagtggtgaggccg
ggggtccttcccgtgtacctggagacggtggagcccggggcagcatactgtgtgaargcc
cggacgtttgtgaaggccatcgggcggcacagtgccttcagcccgacagaatgtgtcaag
gtgcaaggagaggccctgcctctggcgctggccctgtttgccttcgtgggcttcatgctg
atcctggtggtggcgctgctctccgtctggaagatgggccggctgctccggcactcctgc
tgccccgtggtgatgctccccgacaccttgaaaataacaaattcaccccagaagttaatc
agctgcagaaaagaagaggtagaagcctgtgtgacctcagggctctcttctgaggagctc
ctcaaggcctggatctag

KEGG   Bos indicus (zebu cattle): 109560475
Entry
109560475         CDS       T04792                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04072  Phospholipase D signaling pathway
biu04144  Endocytosis
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04540  Gap junction
biu04630  JAK-STAT signaling pathway
biu04810  Regulation of actin cytoskeleton
biu05163  Human cytomegalovirus infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109560475 (PDGFRA)
   04014 Ras signaling pathway
    109560475 (PDGFRA)
   04015 Rap1 signaling pathway
    109560475 (PDGFRA)
   04630 JAK-STAT signaling pathway
    109560475 (PDGFRA)
   04020 Calcium signaling pathway
    109560475 (PDGFRA)
   04072 Phospholipase D signaling pathway
    109560475 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    109560475 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109560475 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109560475 (PDGFRA)
   04540 Gap junction
    109560475 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109560475 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109560475 (PDGFRA)
   05206 MicroRNAs in cancer
    109560475 (PDGFRA)
   05230 Central carbon metabolism in cancer
    109560475 (PDGFRA)
   05231 Choline metabolism in cancer
    109560475 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    109560475 (PDGFRA)
   05218 Melanoma
    109560475 (PDGFRA)
   05215 Prostate cancer
    109560475 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109560475 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109560475 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109560475 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109560475 (PDGFRA)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109560475 (PDGFRA)
Protein kinases [BR:biu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109560475 (PDGFRA)
CD molecules [BR:biu04090]
 Proteins
  109560475 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set C2-set_2 Kinase-like LAT
Other DBs
NCBI-GeneID: 109560475
NCBI-ProteinID: XP_019818324
UniProt: A0A6P5BYE1
LinkDB
Position
6
AA seq 1089 aa
MGTSHWALLVLGCLFTGLSLILCQLSLPSILPNENERVVQLNSSFSLRCFGESEVSWQYP
MSEEEYPDVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQMDENEIEGRHIYIY
VPDPDVAFVPLGMTDSLVIVEDEDSVIIPCRTTDPETPVTLLSSEGIVPASYDSRQGFKG
TFSVGLYICEATVRGKKFQTIPFNVYAYTATSKLDLEMESPKTVYKAGESIVVTCTVFNN
EVVDFQWTYPGQMKGKGITRLEETKFPSIKLVYTLRVPEATVKDSGDYECAAHQATKEVK
KMRNVTISVHEKGFIEIKPNFNLLEAVNLHEVKHFVVDVQAYPPPKITWLKDNLTLIENL
TEITTDIEKIQEISYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSNGGQTVRCTAEGTPLPDIEWMVCKDIKKCNNETSWTVLANNVSNIITGVHPRD
RSTVEGQVTFAKVEETIAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRALYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccattgggcactcctggtcttaggctgtctcttcacagggctgagccta
atcctctgccagctttcattaccctccatcctgcccaatgaaaatgagagggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagtaccccgacgtggaaatcagaaacgaggagaacaacagtggcctt
tttgtgacagtgctggaagtggtcagcgcctcggcggcccacactgggctgtacacttgc
tattacaaccacacgcagatggacgagaacgagatcgagggcaggcacatttacatctac
gtgccagacccagatgtagccttcgtacctctaggaatgacagattccttggtcatcgtg
gaggacgaagattcggtcatcatcccatgccgcacgactgatcctgagactccagtgacc
ttactcagcagtgaggggatagtgcctgcctcctatgacagcagacaaggctttaaagga
accttcagtgtcgggctctatatctgtgaggccacggtcagagggaagaagttccagacc
attccattcaatgtttatgcttacacagcaacatcaaaacttgatctggaaatggaatct
cctaagactgtgtataaggcaggcgaatcaattgtggtcacctgcaccgtctttaacaac
gaggtggttgactttcagtggacttaccctggacaaatgaaaggcaaaggcatcacgagg
ctggaggaaaccaagttcccgtccatcaagttggtgtacactctgagggttcccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccaccaggccaccaaggaggtcaaa
aagatgaggaacgtcaccatttctgttcacgagaaaggatttattgaaatcaaacccaac
tttaacctgttggaagctgtcaacctgcatgaagtcaagcattttgtggtggatgtgcag
gcctatccccctcccaagataacctggctaaaggacaacctgactctgattgagaatctc
acggagatcaccactgacatagaaaagattcaggaaataagttatcgaagcaaattaaag
ctgatccgagcaaaggaagaagacagcggccattatactattgtagttcaaaatgaagat
gatgtgaagagctatacttttgaactcttgactcaagttccatcctccatactggacttg
gttgacgaccaccatggctctaatgggggccagactgtgagatgcacagccgaagggacc
cctcttcctgatatcgagtggatggtttgcaaggatattaagaaatgtaacaatgaaact
tcatggacagttttggccaacaacgtttcaaacatcatcacaggggtccacccccgagac
aggagcacagtggaaggccaggtgacatttgccaaagtggaggagaccattgcagtccgg
tgtctggccaagaacctcctcggggtggaaagccgagagctgaagctggtggctcccact
ctgcgctctgagctcactgtggcggctgctgtcctggtgttgttggtgattgtgatcatc
tcactcattgtcctggtcgtcatttggaaacagaaaccaaggtatgaaatccgttggagg
gtcattgaatcaatcagccctgatggacatgaatacatttatgtggacccgatgcagctg
ccttacgactcgagatgggagtttccaagagatggactcgtgcttggtcggatcctgggg
tctggtgcatttgggaaagtggttgaaggaactgcttatggattaagtcggtctcaacct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgacccacctggggccacatttaaacatcgtgaacttg
ctgggcgcctgcaccaagtcaggccccatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccaccatccagagaag
ccaaagaaagagctggacatttttggattgaacccggctgacgaaagcacaagaagttac
gttatcttatcttttgaaaataatggtgactacatggacatgaagcaagctgacacgaca
cagtatgtccccatgctggagagaaaagaggtttctaaatactcggacatccagagagcg
ctgtatgatcgcccagcctcgtataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggcctgactttgttggatttgttgagctttacctat
caagtcgcccgaggaatggagtttttggcttcaaaaaattgtgtccatcgggacctggcg
gctcgcaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactacgtgtccaaaggcagtacctttctccccgtgaag
tggatggctcctgagagcatctttgacaacctgtacaccacgctgagtgacgtctggtcc
tatggcatcctgctctgggagatcttttcccttggtggcacaccctaccctggcatgatg
gtggactctacattctacaataagatcaagagtggataccggatggccaagcctgaccat
gccaccagtgaagtctacgagatcatggtgaagtgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgaaattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagatccacctggactttctgaagagtgaccatcccgctgtggcacgcatg
cgcgtggactccgacaacgcctacattggcgtcacctacaaaaatgaggaagacaagctg
aaggactgggagggtggcctcgacgagcagaggctgagtgcagatagcggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaagacctgggcaagaggaacagacac
agctcacagacctctgaagagagtgccattgagacaggttccagcagttctacgttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggatctggtggaggacagcttcctgtaa

KEGG   Bos indicus (zebu cattle): 109560896
Entry
109560896         CDS       T04792                                 

Gene name
IL27RA
Definition
(RefSeq) interleukin-27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109560896 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109560896 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109560896 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109560896 (IL27RA)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL6/12 receptor family
   109560896 (IL27RA)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 109560896
NCBI-ProteinID: XP_019818916
UniProt: A0A6P5C015
LinkDB
Position
7
AA seq 433 aa
MRGTPAAPFPPRPKPMLLLLLFFFFSRTRPQXXFWSELVSHARERAHHPPGQPGATAVLW
SWTLGGLNCSWEPHGDLGAPSMLYVQSQKYHSNKTWTVAVPTGQNWVTIPREQLTTSDEL
LVWAAKAGQLLWSPVFVNLETRMKPDAPHLYPDVDFSDDHPLEAVVQWAPPTWPPHKVLV
CRFYYRRCRMPWVMLEPEVKSIPLMPIEIQDLELATGYEMFGRCQVDKEEDLWGEWSPIL
PFQTPPSAPKDVWIMGNICGAPGGQEPLLLWKASGLCMQVTYRVWIQVKDQEVIQEETPY
CNFSIPTQAEWVGVSAVNATSWELPTNLSLTCLGPDXAPHGVVVRSISGNTELLVTWQQE
PGELQEHVVDWIRDGDPVEDLNWVRLPPGNLSAVLPGEAEEHQGSHFSCWRTEERLDLQR
SGQVLLIHARNIR
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgcgggggaccccggccgcccccttcccaccgcggccgaagccgatgctgctgctgctt
cttttttttttttttagtcggactcggccccaggktkagttctggagcgagctcgtgtct
catgctcgcgaacgcgcccatcaccctccagggcagcccggggccactgcagtgctatgg
agttggacccttgggggactgaactgctcctgggagcctcatggggacctgggagccccc
tccatgctgtatgtccaaagccagaaataccattccaacaaaacctggaccgtggcggtg
cccactggacagaactgggtgaccatcccacgggaacagctcaccacgtctgacgaactc
cttgtctgggcggccaaggccggccagcttctctggtccccagtctttgtgaacctcgaa
acccgaatgaagccggatgccccccacctataccctgacgtggacttctcagatgaccac
cccctggaggccgttgtccagtgggcccctcctacgtggccaccccataaggtcttggtc
tgccggttttactatcgaaggtgccggatgccctgggtgatgctggaaccggaagtgaag
tctatacctctgatgcccattgagatccaggacctggaactggccactggctacgagatg
ttcggccgctgccaagtggacaaagaggaggatctgtggggcgagtggagccccattctg
cccttccagacaccaccctctgctccaaaagatgtgtggatcatggggaacatctgtggg
gcaccaggtggacaggaacccctgcttctgtggaaggcttcagggctctgcatgcaggtg
acctacagagtctggatccaggttaaggatcaggaggtgatccaggaggagaccccctac
tgcaacttctccatccccacccaagcagagtgggtgggggtgtctgctgtgaatgccaca
agctgggagcttcctaccaacctctctttgacctgcttgggtccagactytgccccccat
ggcgtggtggtcaggagcatctctggaaacacagagctgctggtgacttggcaacaggag
cctggggagctgcaggagcatgtggtggactggattcgagacggcgaccccgtggaggac
ctcaactgggtccggcttcctcctgggaacctcagtgcagtgttgccaggtgaggccgaa
gagcaccagggttcccatttcagctgttggagaacagaggagaggctggatttgcagagg
agyggtcaagtattattaattcatgcaagaaatattcgttga

KEGG   Bos indicus (zebu cattle): 109561420
Entry
109561420         CDS       T04792                                 

Gene name
IL12RB1
Definition
(RefSeq) interleukin-12 receptor subunit beta-1 isoform X1
  KO
K05063  interleukin 12 receptor beta-1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu05200  Pathways in cancer
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561420 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561420 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109561420 (IL12RB1)
   04659 Th17 cell differentiation
    109561420 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561420 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109561420 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109561420 (IL12RB1)
   04090 CD molecules [BR:biu04090]
    109561420 (IL12RB1)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL6/12 receptor family
   109561420 (IL12RB1)
CD molecules [BR:biu04090]
 Proteins
  109561420 (IL12RB1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N Interfer-bind fn3_4 DUF1935
Other DBs
NCBI-GeneID: 109561420
NCBI-ProteinID: XP_019819415
UniProt: A0A6P5C1R9
LinkDB
Position
7
AA seq 726 aa
MGQWGFRLVALLLLLRHRQGAEACSTVGCCFQNPPYPDADSGSASGPRAPSCYRVFSSAG
YECSWEYEGPAAGVSHFLRCCLQSGRCCYFATGSATKLQFSDQDGISVLHNVTLWVESRA
ANRTEKSPNVTLNLYSSVKYDPPPENIKVSKSAGKLRMEWETPARQDGAQVQFRHRTPGS
PWKLGDCGHQDDAGFESCLCPLEMDMAQEFQLRRRLGPGVPRGPWSSWSSPVCIPPETPP
QAEVRFSVEQLRPDGRRQVTLHEQLPQLELPEGCLGPDSGMEVTYHIHLHMLSCPCKTRA
KRTLRLKKKLVLSSAAYDLAVVSRNRFGLGPNQTWHIPACIHSEPGLLNISAGANGTTIR
WPARAQGMRYCIEWQLQGQEENLAACIVTAPQDPDAAGTATHSWSQESGALEQKACYRIT
IFASAHPEKPTSWSTVLSTYHFGGNASEAGSPQHVSVRKLSQDSVSVDWTPSLLSTCPGV
LKEYVVCCQEEDSNQVSELHVKPTETQVTLQGLRAGTAYKVQVRADTAKRRGAWSQPLRF
SIEVQVSELSDLSIFLASLGSFVSILLLGIFGYLGLNRAVRHLCPPLPTPGASTAIKFSG
SQGKQVWQWTSPADFPEEVSPQEALMVNISWEKGEGADMGTLGTLKEKTELPLHAPKPAL
DLKDRKQMQGCPEAGAPGPGWQDGLVEDSLAQAARSPLLILGGLGWTPRFGSQGETGASA
SSYREA
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggggcaatgggggttcaggctggttgccctccttctcctcttgcgccacagacagggc
gctgaagcctgcagtaccgtcggatgctgttttcagaacccaccatacccagatgcagac
tcaggctcagcttcaggccccagggccccaagctgctaccgggtgttcagcagcgctggt
tatgaatgttcctgggagtacgagggccctgcagctggagtcagccacttcctcagatgc
tgcctccagtctggccgctgttgctactttgccacaggctcrgccaccaagctgcagttc
tccgaccaggatggcatatccgtgctccacaatgtcactctctgggtggaatcccgggcc
gccaaccggacagagaagtcccccaacgttaccctgaacctctacagctcagttaaatac
gaccctcccccagaaaacatcaaggtgtccaagtcagcagggaagctgcgtatggartgg
gagaccccagcccgccaggatggtgcccaggtacagttccggcaccgcacacctggcagc
ccgtggaagctgggtgactgtggacatcaggatgatgctggcttcgagtcatgcctctgc
cccttggagatggacatggcccaggaattccagctgcggcggcgtctggggccaggggtc
cccagaggtccctggagcagttggagcagccctgtgtgcatcccccctgaaacccctcca
caggctgaggtgaggttctcagtagagcagcttcgcccagatgggaggaggcaggtgacc
ctgcatgagcagctgccccaactggagcttccggaaggctgccttgggcctgactctggg
atggaggtgacctaccacatccatctgcacatgctgtcctgcccatgtaagaccagggcc
aagaggactctgcgyctgaagaaaaagctcgtcctctcgagtgctgcctatgatctggcc
gtcgtttcccggaatcgctttggcctcggccccaatcagacatggcacattcctgcctgc
atccactcagaaccagggcttctgaatatcagtgccggagccaacgggactaccatacgg
tggccagcccgggcccagggaatgaggtactgcattgagtggcagctccagggccaggag
gagaaccttgccgcctgcatcgtgacggccccccaggacccggatgctgctgggacggca
actcacagctggagccaagaatctggggcattggaacagaaggcatgttaccgcatcacc
atctttgcctctgcacacccagagaagccaacctcatggtctacggtcttgtccacctac
cattttggaggcaatgcctcagaggccggaagcccacagcacgtgtcggtgaggaaactc
agccaggattcggtgtctgtggactggacaccatctctgctgagcacctgccctggcgtc
ctgaaggagtatgttgtgtgctgccaggaggaggacagcaaccaagtatctgagctgcac
gtgaagcccacagagacccaggtcaccctccaaggcctgcgggctggcacagcttacaag
gtgcaggttcgcgcagatacagccaagcggaggggtgcctggagccagcccctgcgtttc
agcatcgaagtccaggtttctgagttgtccgacttgtccatcttcctcgcatctttgggg
agtttcgtgagcatccttctcctgggaatctttgggtacctcggcttgaacagggctgta
aggcacctgtgcccacccctgcccacacctggtgccagcactgccatcaagttctctggc
agccaggggaagcaggtttggcagtggaccagcccagcagacttcccggaggaggtgtct
ccacaagaggccctgatggtgaatatatcctgggaaaaaggcgagggagctgacatgggc
acacttgggactctcaaggagaagacggagctgcctctgcatgcccctaagccagccctg
gacttgaaggacaggaagcagatgcaaggatgccctgaggctggggctccggggcctggc
tggcaggacggtctggtggaggacagccttgcccaggcggctaggtccccactgctgatc
ctggggggcctagggtggacccccaggttcggttcccagggagaaacaggagcgtctgcc
tcctcctacagagaagcctga

KEGG   Bos indicus (zebu cattle): 109561621
Entry
109561621         CDS       T04792                                 

Gene name
EPOR
Definition
(RefSeq) erythropoietin receptor isoform X1
  KO
K05079  erythropoietin receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561621 (EPOR)
   04151 PI3K-Akt signaling pathway
    109561621 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561621 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109561621 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561621 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109561621 (EPOR)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  Prolactin receptor family
   109561621 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 109561621
NCBI-ProteinID: XP_019819767
UniProt: A0A6P5C3K6
LinkDB
Position
7
AA seq 508 aa
MYHLPAPLRAGIGFLCLLLAGAAWAPPPNPTDPKFENKAALLTAREPDEFLCFTERLEDL
VCFWEEAATAGVGPDNYSFSYQLEGEPWKPCRLHQAPTARGLVRFWCSLPTADTSSFVPL
ELHVTAASGASRYRRTIHVNEVVLLDPPARLVARRADEGGHVVLRWLPPPGAPMASLIRY
EVNISAENAAGSAQRVEILDGRTECLLSNLRGGTRYTFMVRARMAEPSFGGFWSAWSEPA
SLLTASDLDPLILTLSLVLVLILLLLAVLALLSHRRTLKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQTDGCLWWSPSTPLPEDPPAPLEVLSECCWGVTQAVEPGADDGGPLLEPVG
SEHAQDSYLVLDKWLLPRSPPSEDLLQPGGDMDIVTMDEASEASSCTSALALKPGPEGAS
ATSFEYTILDPSSQLLRPRALPPELLPTPPHLKYLYLVVSDSGISTDYSSGGSQEAQGGS
SNGPYSNPYENSLIPAPKPSPPSYVACS
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtatcatctcccggcacccctccgggctggaattggcttcctctgcctcttgctcgct
ggggcagcctgggctcccccacccaatccaacggaccccaagtttgaaaacaaagcggcc
ctgctgacagcccgcgagcctgatgagtttctgtgcttcaccgagcgcttggaggatttg
gtgtgtttctgggaggaagcggccaccgccggagtcggcccagacaactacagcttctct
tatcagctcgagggtgagccgtggaagccatgccgcctgcatcaggcacccaccgcccgc
ggcttggtgcgtttctggtgctcgctgcctacagccgacacgtcgagcttcgtgccccta
gagctgcacgtcactgcggcctcgggcgcttcacgctaccgccgtaccattcacgtcaac
gaagtggtgctcctagaccctcccgccaggcttgtagctcggcgggccgacgagggcggc
cacgtggtactgcgctggctcccgccgcctggggcacccatggcgagccttatccgctat
gaggtgaatatctcggcagagaacgccgcagggagcgcacagagggtggagatcctcgac
ggccgcaccgagtgcttgctgagcaacctgcggggcggaacgcggtacaccttcatggta
cgcgcgcgtatggccgagcccagcttcggtggcttctggagcgcctggtccgagcccgcg
tcactgctgacggctagtgacttggaccccctcatcctgacgctctccctcgtcctcgtg
ctcattctgctgctgctggccgtgctggccctgctatcccaccgccggactctgaagcag
aagatctggcctggcatcccaagccctgagagcgagtttgaaggcctcttcacaacccac
aagggtaatttccagctgtggctgtaccagactgacgggtgtctgtggtggagccccagc
acccccctcccagaggacccacctgcccccctggaagtcctctctgagtgctgctggggg
gtgacacaggcagtggaacctggggcagatgacggggggcccctcctggagccagtgggc
agcgagcatgcccaagacagctacctggtactggacaagtggttgctgccccggagtccg
ccgagcgaggatctcctgcagcctggtggcgatatggacatagtgaccatggatgaagcc
tcagaagcgtcctcctgcacatccgctttggccctgaagcctgggccggagggggcctct
gctactagctttgagtacaccattcttgaccccagctcccagctcttgcgcccaagggca
ctgccccctgagctgctccccaccccaccccacctaaagtacctgtacctcgtggtgtct
gactctggcatctcaactgactacagctcagggggttcccaggaagcccaggggggttca
tccaatggtccctactccaacccttatgagaacagcctcatcccagcccccaagccttca
cccccaagctacgtggcctgctcctag

KEGG   Bos indicus (zebu cattle): 109562197
Entry
109562197         CDS       T04792                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04072  Phospholipase D signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04540  Gap junction
biu04630  JAK-STAT signaling pathway
biu04810  Regulation of actin cytoskeleton
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109562197 (PDGFRB)
   04014 Ras signaling pathway
    109562197 (PDGFRB)
   04015 Rap1 signaling pathway
    109562197 (PDGFRB)
   04630 JAK-STAT signaling pathway
    109562197 (PDGFRB)
   04020 Calcium signaling pathway
    109562197 (PDGFRB)
   04072 Phospholipase D signaling pathway
    109562197 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    109562197 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109562197 (PDGFRB)
   04540 Gap junction
    109562197 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109562197 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562197 (PDGFRB)
   05206 MicroRNAs in cancer
    109562197 (PDGFRB)
   05230 Central carbon metabolism in cancer
    109562197 (PDGFRB)
   05231 Choline metabolism in cancer
    109562197 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    109562197 (PDGFRB)
   05218 Melanoma
    109562197 (PDGFRB)
   05215 Prostate cancer
    109562197 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109562197 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109562197 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109562197 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109562197 (PDGFRB)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109562197 (PDGFRB)
Protein kinases [BR:biu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109562197 (PDGFRB)
CD molecules [BR:biu04090]
 Proteins
  109562197 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6
Other DBs
NCBI-GeneID: 109562197
NCBI-ProteinID: XP_019820791
UniProt: A0A6P5C590
LinkDB
Position
7
AA seq 1121 aa
MKDTMWLPSAMQAVVLKGRVLLLPLLFLLGPQASWGLAIIPPGPELVLNLSSTFVLTCSG
PAPVVWERMSQKPPQEMTETQDGTFSSVLTLVNVTGLDTGEYFCGYKRSHGLEASERKRL
YIFVPDPSVGFLPVDPEELFIFLTEITETTIPCRVTDPRLVVMLHEKKVDVPLPIAYDPQ
RGFSGTFEDKTYICKTTIGDREVDSDAYHVYSLQVSSINVSVNAVQTVVRQGENITIMCI
VTGNEVVNFEWTYPRMESGRLVEPVTDFLFEMPHIRSILHIPSAELGDSGTYICNVSESV
SDHRDEKAINVTVVENGYVRLLGELDPVQFAELHRSRTLQVVFEAYPPPTVMWFKDNRTL
GDSSAGEIVLSTRNVSETRYVSELTLVRVKVAEAGYYTMRAFHEDAEAQLSFQLQVNVPV
RVLELSESHPANGEQTVRCRGRGMPQPHLTWSTCSDLKRVGRDWKSTWPVLGRCPRELPP
TPLGNSSEEESQLETNVTYWAEEQEFEVVSTLRLRHVDQPLSVRCTLHNLLGYDVQEVTV
VPHSLPFKVVVISAILALVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVD
PMQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSS
EKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQR
CSDKRRPPSAELYSNALPVGLPLPSHVSLPGESDGGYMDMSKDESVDYVPMLDMKGDVKY
ADIESSNYMAPYDNYVPSAPERTCRVTLINESPVLSYTDLVGFSYQVANGMEFLASKNCV
HRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTL
SDVWSFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEE
KFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFNGLRSPLD
SSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSP
LEPQEEPEPEPQPASQVEPEPKWPPDSSCPGPRAEAEDSFL
NT seq 3366 nt   +upstreamnt  +downstreamnt
atgaaggataccatgtggcttccgagcgccatgcaagctgttgtcctcaaaggccgggtg
ctattgctgcccctgctgtttctgctgggaccacaggcctcctggggcctggccatcata
cccccggggccagaacttgtcctcaacctctccagcacctttgtcctgacctgctcgggc
ccagctccagtkgtgtgggaacggatgtcccagaaacccccycaggaaatgaccgagacc
caggatggcacattctccagcgtgctgacactggtcaacgtcactggactagacacagga
gaatacttctgtggctacaaacgctcccatgggctggaggccagtgagcgaaaacggctc
tacatctttgtaccagatccttctgtgggcttcctccctgtcgaccctgaggagctattc
atctttctcacggaaataactgagaccacaattccatgccgagtgacggatccgaggctg
gtggtgatgctgcacgagaagaaggtggatgtccccctgcccatagcctatgaccctcag
cgtggcttctctggtacctttgaggacaagacctacatctgcaaaaccaccatcggggac
agggaggtggattccgatgcctaccatgtctacagcctccaggtgtcatccatcaatgtc
tcagtgaatgcagtgcagactgtggtccgccaaggggagaatatcaccatcatgtgcatt
gtgaccgggaatgaggtggtcaacttcgagtggacatacccacgcatggagagtgggcgc
ctggtggagccagtgactgacttcctctttgaaatgccccacatacgttctatcctgcac
atccccagtgctgagctaggagactcagggacctacatctgcaatgtatcagaaagcgtg
agcgaccatcgtgatgaaaaggctatcaatgtcaccgtggtcgagaacggctatgtgcgc
ctgctgggagagctggaccctgtacaattcgccgagctccaccgcagccggacactgcag
gtggtgtttgaggcctacccgccacccactgtcatgtggttcaaagacaaccgaaccctg
ggtgactccagcgccggcgagatcgtgctgtccacacgcaatgtgtctgagactcggtat
gtgtcagagctgacactggtgcgggtgaaggtggctgaggctggctactacaccatgcgg
gccttccatgaggatgctgaagcccagctctccttccagctgcaggtcaatgtgcctgtc
cgtgtgctggagctgagcgagagccaccctgccaatggggagcagacagttcgttgtcgc
ggccggggcatgccccagccacacctcacctggtctacctgcagtgayctcaaaagggtg
ggaagggactggaagtcgacctggccggttctcggcaggtgtccgcgggagctgccgccc
acgccgctggggaacagttccgaggaggagagccagctagagacgaatgtgacgtactgg
gcggaggagcaggagttcgaggtggtgagcacactgcgcctgcgccatgtggatcagccg
ctgtccgtgcgctgcacgctgcacaacctgctgggctacgacgtgcaggaggtcaccgtg
gtgccacattccctgcccttcaaggtggtggtgatctcggccatcctggccttggtggtc
ctcacgatcatctccctcattatcctcatcatgctctggcagaagaagccacgctatgaa
atccgatggaaagtgatcgaatctgtgagctctgatggccatgagtacatctatgtggac
cctatgcagctgccctacgactccacctgggagctgccacgggaccagcttgtgcttgga
cgcaccctgggctccggggcctttgggcaggtggtggaggccacggctcacggcctgagc
cattctcaggctaccatgaaagtggctgtgaagatgctgaaatccacagcccgcagcagt
gagaagcaagccctcatgtcggagctgaagatcatgagtcaccttgggccccacctgaac
gtggtcaacctgctgggcgcctgcactaaaggaggacccatctacatcattaccgagtac
tgccgttayggcgacctggtggactacctgcaccgcaacaagcacaccttcctgcagcgc
tgctcggacaagcgccgcccrcccagcgccgagctctacagcaacgccctgcctgttggg
ctccctctgcctagccacgtgtcactgcctggggagagcgatggtggctacatggacatg
agcaaggaygagtcggtggactatgtgcccatgctggacatgaaaggagatgtcaaatac
gcagacatcgagtcctcgaactacatggctccttatgataactacgtcccctctgctcct
gagaggacttgccgggtgactttgatcaacgagtccccagtgcttagctacacggatctt
gtgggcttcagctaccaggtggccaatggcatggagttcctggcgtccaagaattgtgtc
caccgagacctggcagccaggaacgtgctcatctgtgagggcaagctggtcaagatctgc
gactttggcctggctcgtgacatcatgcgggactcgaactacatctccaagggcagcacc
ttcctgcctctgaagtggatggcccccgagagcatcttcaacagcctctacactaccctg
agcgacgtgtggtccttcggcatcttgctctgggagatcttcacgctgggtggcacccca
tacccagagctgcccatgaacgagcagttctacaacgccatcaagaggggctaccgcatg
gcccagcctgcccacgcctctgacgagatctacgagatcatgcagaagtgctgggaagag
aagttcgagatccggccccccttctcccagctggtgctgcttctcgagagactgctgggt
garggctacaaaaagaagtaccagcaggtggatgaggagtttctgaggagcgaccaccca
gccatccttcggtcccaagcccgcttgcctggcttcaatggcctccgatctcctctggac
tccagctccgtcctctatactgctgtgcagcccaacgagggggacaatgactacatcatc
cccctgcctgaccccaaacctgaggttgctgatgagggcccactggagggttcccccagc
cttgccagctccaccctgaatgaagtcaacacctcctccaccatctcctgtgacagccct
ctggaaccccaagaggagccagagccagagccgcagcccgcctcccaggtggagccagag
cccaagtggccgccrgattcmagctgccccgggcctcgggccgaggcggaggacagcttc
ctgtag

KEGG   Bos indicus (zebu cattle): 109563190
Entry
109563190         CDS       T04792                                 

Gene name
CNTFR
Definition
(RefSeq) ciliary neurotrophic factor receptor subunit alpha
  KO
K05059  ciliary neurotrophic factor receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109563190 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109563190 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109563190 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109563190 (CNTFR)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL6/12 receptor family
   109563190 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Receptors
  109563190 (CNTFR)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_2 ig Ig_5
Other DBs
NCBI-GeneID: 109563190
NCBI-ProteinID: XP_019822003
UniProt: A0A6P5C944
LinkDB
Position
8
AA seq 372 aa
MAAPVPWACCAVLAAAAAVVYAQRHSPQETPHVQYERLGSDVTLPCGTASWDAAVTWRVN
GTDLAPDLLNGSQLVLRSLELGHGGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKMMVCEKDPAVKNRCHIRYMHLFSTVKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELGSGGAASAPSFVSVPVTLAL
AAVAATASRLLI
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgctcctgtcccgtgggcctgctgtgccgtgctcgctgctgctgctgccgtggtc
tacgcccagagacacagtccgcaggagactccccacgtgcagtacgagcgcctgggctca
gacgtgactctgccgtgtgggactgccagctgggacgcagcggtgacgtggcgggtgaat
ggcacagacctggcccctgacctgctcaacggctctcagctcgtgctccggagcctggag
ctgggccacggcggcctgtacgcctgcttccaccgggactcctggcacctgcgccaccag
gtgcttctccatgtgggcttgccgccgcgggagcccgtgctcagctgccgctccaacact
tatcccaagggcttctactgcagctggcatctgcccactcccacctacatccccaacacc
ttcaatgtgaccgtgctgcatggctccaaaatgatggtctgtgagaaggacccggccgtc
aagaaccgctgccacatccgctacatgcacctgttctccaccgtcaagtacaaggtctcg
ataagtgtcagcaacgccctgggccacaatgccacagccatcacctttgatgagttcacc
atcgtgaagcctgaccctccggaaaatgtggtagcccggccagtgcccagcaaccctcgc
cggctagaggtgacgtggcagaccccgtcgacctggcccgaccccgagtcctttcctctc
aagttctttctgcgctatcgacccctcatcctggaccagtggcagcatgtggagctgtca
gacggcacggcacacaccatcacagatgcctacgctggcaaggagtacatcatccaggtg
gcggccaaggacaacgagattgggacgtggagcgactggagcgtggctgcccacgccacg
ccctggacggaggagccacgacacctgaccactgaggcccaggcccccgagaccacgacc
agcaccaccagctcactggcacccccgcccaccacgaagatctgtgaccccggggagctg
ggcagcggcggggcagcctcggcgccctccttcgtcagtgtccctgttactctggccctg
gctgccgttgctgccactgccagccgtctcctgatctga

KEGG   Bos indicus (zebu cattle): 109563195
Entry
109563195         CDS       T04792                                 

Gene name
IL11RA
Definition
(RefSeq) interleukin-11 receptor subunit alpha
  KO
K05056  interleukin 11 receptor alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109563195 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109563195 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109563195 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109563195 (IL11RA)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL6/12 receptor family
   109563195 (IL11RA)
SSDB
Motif
Pfam: fn3 Ig_3 EpoR_lig-bind Ig_2 ig
Other DBs
NCBI-GeneID: 109563195
NCBI-ProteinID: XP_019822013
UniProt: A0A6P5C952
LinkDB
Position
8
AA seq 422 aa
MSSSCSGLSRVLVAVAAALVSASSPCPQAWGPPGVQYGQLGRALMLCCPGVTAGAPVSWX
RDGETRLLQGPASGLGPKLVLARAESTDEGTYTCRTLDGALRGMVTLRLGYPPARPVVSC
RAADYENFSCTWSPSQVSGLPTRYLTSYRKKTVPGADGQRMSPSTGPWPCLQDPPGAARC
IVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPRQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHVVRVSARDFLD
AGTWSSWSPEAWGTPSTEPLPKEMPVGDQQHTQTEEEPQADSPAPPKPSLLPDPQPLDHR
DPLEQVAVLASLGIFSFLGLVAGALALGLWLRLRPDEKDGPQKSGLLAPMISVDKLPGVP
NL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgagcagggtcctggtggccgtggctgcagccctggtg
tctgcctcctctccctgcccccaggcctggggccccccaggggtccagtatgggcagctt
ggcagggccctgatgctgtgttgccctggagtgactgctggggccccggtgtcctggytt
cgggacggggagacaaggctgctccagggacctgcctctgggctagggcccaaactggtc
ctggcccgagcagaaagcactgacgagggcacctatacctgccggaccctggacggtgca
cttaggggcatggtgaccctgcggctaggctaccccccggcccgccccgttgtttcctgc
cgggctgctgactatgagaacttctcctgcacttggagtcccagccaggttagcggttta
cccacccgctacctcacctcctacaggaagaagactgtgccgggagctgatggccaaagg
atgagcccatccacagggccctggccatgcttacaggacccccctggggcggcccgctgt
atagtccatggggcagagttctggagccagtatcggatcaatgtgactgaagtgaacccc
ctgggggccagcacccgcctgctggatgtgagcttgcagagcatcttgcgccctgacccg
ccccagggcctgcgggtagagtcagtgcctggctatcctcgccgcctgcgtgctagctgg
acataccctgcctcctggccccgccagccccacttcctgctcaagttccgtctgcagtac
cgtccagcacagcatccagcctggtctacggtggagccagctggattggaggaggtgatc
accgatgctgtggctgggctgccccatgtagtgcgggtcagcgcccgggactttctggat
gctggcacctggagctcctggagccccgaggcctgggggactccaagcactgagccccta
ccgaaggagatgccagttggggaccagcaacacacacagacagaggaagaacctcaggca
gacagccccgctcccccaaagccgtcccttctacccgacccacagccacttgaccacaga
gaccccctggagcaggtggccgtgctggcatctttgggaatcttctctttcctgggactg
gtggctggggccctggcattggggctctggctaaggttgagaccagatgagaaggatgga
ccccaaaaatctgggctcttggccccaatgatttcagtggacaagcttccaggagtccca
aacctgtag

KEGG   Bos indicus (zebu cattle): 109563556
Entry
109563556         CDS       T04792                                 

Gene name
IL22RA2
Definition
(RefSeq) interleukin-22 receptor subunit alpha-2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109563556 (IL22RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109563556 (IL22RA2)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL10/28 receptor family
   109563556 (IL22RA2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 109563556
NCBI-ProteinID: XP_019822493
UniProt: A0A6P5CAI5
LinkDB
Position
9
AA seq 230 aa
MTPKCCFLGFLLSVLLPGVVETQPANESLKPQRVHFQSRNFHNILRWQPGQACLGNNSIY
FVQYKMYGERQWKNKETCWGIREFFCDLTNETSDIWEPYYGRVKTALAGIHSGWTMTQRF
IPWWETKIDPPVMNITHVNGSLLVNLHAPNLPYRDQEGENVSMEYYELVYRVFIFNNSLE
KEQKVYEGAHRVVEIKVTSPHTGYCVVAELYQPMLDRKSQRSRERCMETP
NT seq 693 nt   +upstreamnt  +downstreamnt
atgacgccgaaatgttgctttctaggcttcctcctcagtgtcctcctgcctggtgtggta
gaaactcagccagccaacgagtctctgaaacctcaacgagtccattttcaatcccgaaat
tttcacaacattttgcgctggcagcctggacaagcttgtcttgggaacaacagtatctat
tttgtgcagtataaaatgtatggagagagacagtggaaaaataaagagacctgctggggg
attcgagagttcttctgtgaccttaccaatgaaacatcagatatatgggaaccttattat
gggagagtgaagacagctctggctgggatccactcaggctggaccatgacacagcggttc
attccatggtgggaaacaaaaatagatcctccagtcatgaatataacccacgttaatgga
tctttgttagtaaatctccatgctcccaacttaccatacagagaccaagaaggggaaaat
gtgtcaatggaatactatgagctagtatatcgagtcttcatatttaacaattcactggaa
aaggagcaaaaggtgtatgaaggagctcacagagttgttgaaattaaagttacctcacct
cacactggttactgtgtagtggctgagttataccagcccatgttagacagaaaaagtcag
agaagccgagagagatgcatggaaactccttga

KEGG   Bos indicus (zebu cattle): 109563983
Entry
109563983         CDS       T04792                                 

Gene name
IL20RA
Definition
(RefSeq) interleukin-20 receptor subunit alpha
  KO
K05136  interleukin 20 receptor alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109563983 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109563983 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109563983 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109563983 (IL20RA)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL10/28 receptor family
   109563983 (IL20RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 CRIM Apc13p
Other DBs
NCBI-GeneID: 109563983
NCBI-ProteinID: XP_019823053
UniProt: A0A6P5CC35
LinkDB
Position
9
AA seq 558 aa
MCAPGPSARAAARGAPAPGLPALLFLLLVAAPTGRAVPCVSGDLPKPTNVAFISINMKNI
LQWNPPEGLQGMEVSYTVQYFIYGQKKWLNKSECRNISRTYCDLSAETSDYEHQYYAKVK
AMWGTNCSKWAETGRFYPFLETQIGPPEVALTTDEKSISIVLTAPKKWKKNPEESSISMQ
QIYSNLKYNVSIYNTKSNRTWSQCVTNHTLVFSWLEPGTLYCVLVESFVPGPPRLTHPSE
RQCVSTLEDQTTALEVKIILWYVLPISVTVFIFSVMGYSMYRYIHVGKEKHPANLVLIYG
NEFDKRFFVPTEKIVINFITLNILEDSKTSSKDISVMEKSSEASDLNEPIEDQEPHWEDV
GAEHLGYVSHAVDIVCDFEKSSKGTSLTQQEPPSRTTPMDKTVIEYEYDVRSSDISVGPR
GQEFNLQEEVSLQGKIFEQQAPLADLGPQTLLCSYTPQLRDLDHLRQGHVDTEEGPEEEP
STTLVDWDPQTGKLCIPSLPSFQHDPEGCGHPESEGLGEEGLLSRLYQDQAPDKAPEENE
AYLMQFMEEWGLYVQMED
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgtgcgcccccggaccctcagcgagggcggcggccagaggagccccggcacccggcctc
ccggccctgctgttcctgctgctggtggccgcgccgacgggacgggcagttccctgtgtc
tctggtgatctgcctaaacctacaaatgtcgccttcatatccataaacatgaagaatatc
ctacagtggaaccccccagagggcttacaaggcatggaagttagttacactgtgcagtat
ttcatatatgggcaaaagaaatggctgaataaatctgaatgcagaaatatcagtaggacc
tactgtgacctctctgctgaaacttctgactatgaacatcaatattatgctaaagttaag
gccatgtggggaacaaattgttccaaatgggcagaaactggacgattctatcctttctta
gaaacacaaattggcccaccagaggttgctttgactactgatgagaaatccatttctatt
gttctgacggctccaaagaagtggaagaaaaatccagaagaaagctctatttccatgcaa
caaatatactctaatctgaagtataatgtgtctatatataatactaaatccaatagaacg
tggtcccagtgtgtgacaaaccacactctggtgttcagctggctggagccgggcactctg
tactgtgtactcgtggagtcctttgtcccaggccctcctcgcctcactcacccttctgag
aggcagtgtgtcagtactctagaagatcaaacaacagcattggaggttaaaatcatcctc
tggtatgttttgcccatatctgttactgtgtttattttctctgtgatgggctactccatg
tacagatatatccatgtcggcaaagagaaacacccagcaaatctggttttgatttatgga
aatgaatttgacaaaagattttttgtacctactgaaaaaattgtgatcaacttcatcacc
ctcaatattttggaggattctaaaacttcttccaaggatataagtgtaatggagaaaagc
agtgaggcatcagacctgaatgagcccatcgaggaccaggaaccccactgggaggatgtg
ggggcggaacatctgggctatgtgtcacatgcggtggacatcgtatgtgactttgagaaa
agctccaaagggacgtccttaacccagcaagagccacccagcagaacaacgcccatggat
aaaacagtcattgaatatgaatatgatgtaagaagtagtgacatttctgtggggcctaga
ggacaggagttcaatttgcaggaagaggtgtcccttcaaggaaagatatttgaacaacag
gcacctttagcagacttgggtccacaaacactgctgtgttcatatacccctcagctcaga
gacttggaccacctgcggcaggggcatgtggacacagaggaggggccagaggaagagccg
tccaccacgctggttgactgggaccctcagactggcaagctgtgtataccttcattaccc
agctttcaacatgacccagagggatgtggccatcctgaatctgaggggctcggggaggag
ggcctcttatctagactctaccaggaccaggctccagacaaggcaccggaagaaaatgaa
gcctatctcatgcaatttatggaagaatggggattatatgtacaaatggaagactaa

KEGG   Bos indicus (zebu cattle): 109563984
Entry
109563984         CDS       T04792                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04066  HIF-1 signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05164  Influenza A
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05200  Pathways in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109563984 (IFNGR1)
   04066 HIF-1 signaling pathway
    109563984 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109563984 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109563984 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109563984 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    109563984 (IFNGR1)
   04659 Th17 cell differentiation
    109563984 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109563984 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109563984 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109563984 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109563984 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109563984 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    109563984 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    109563984 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109563984 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109563984 (IFNGR1)
   05140 Leishmaniasis
    109563984 (IFNGR1)
   05142 Chagas disease
    109563984 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109563984 (IFNGR1)
   04090 CD molecules [BR:biu04090]
    109563984 (IFNGR1)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IFN receptor family
   109563984 (IFNGR1)
CD molecules [BR:biu04090]
 Proteins
  109563984 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 109563984
NCBI-ProteinID: XP_019823054
UniProt: A0A6P5CCJ6
LinkDB
Position
9
AA seq 500 aa
MVFGGGSDARPKAEVRAGVYPPWCWAAPALVWSNMALLFFLVPVLLTGSWVEMSAAIPGL
SSVPPPTNVTIQAYNLNTVIFWDYPVILQSPMFTVQVMNYEDGKWIDACNTSDHSCNIFS
VINDPSSSVWGRVKVRVGQEESVYAQSKEFILCKEGKVGPPKLGIRKKENQIIVDIFHPL
ITVNGKEPEAMYDDENTCYTFTYSVFVSINRSETTDKMYTKEEDCNETQCFLNIPVSSLN
SQYCVSAEGVSELWAVTTEKSDELCITFSDDNNTEDPVWIPIVAALLLFLVFALVVVCCI
IKKFYPIKREGTKLPKSLLSVVKNASSEAKFDSKIISPITYQPIAVENEQLSPGTISSLH
TEDNPGKVEHGDLSSEMEVVTIEENISDLAPCSPLTPEREDSIHASSNQSESCSITLNAY
HSRNGSDSGLAVSDNCSSSEFPPSNKTEVKTEGQDFITLRNTTTSFGYDKPHVLVDLLVD
EGGKESLIGYRLTADSREFS
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggttttcggcggaggaagtgacgcaagacctaaggccgaggtccgcgcgggtgtatac
ccgccgtggtgctgggcagcacccgcgttagtctggagcaacatggctctcctctttttc
ctcgtccctgtcttgctgaccggaagctgggttgagatgagcgccgcgattccaggactt
tcttcggtgccaccaccaaccaatgttacaatacaagcctacaacttgaacacggttata
ttttgggactatcctgttatactacagagtcctatgtttaccgtacaagtgatgaactat
gaggacgggaaatggattgatgcctgcaatacctctgatcattcttgtaatatcttttct
gtaattaatgatccatcaagttctgtctggggtagagttaaagtcagggttggacaagaa
gaatctgtctatgcacagtccaaagaatttattttatgcaaagaagggaaagttggacca
cctaaactgggtatcagaaagaaggaaaaccaaatcattgttgatatatttcacccttta
attactgtaaatggaaaagagccagaagctatgtatgatgatgaaaatacttgttataca
ttcacatacagtgtgtttgtgagcatcaacagaagcgagactacggataaaatgtacacg
aaggaagaggattgtaacgagactcagtgcttcttaaatattcctgtgtcctcactgaat
tctcagtactgtgtttcagcagaaggagtctcagaattatgggctgttacaactgaaaag
tctgatgaactttgtattaccttttctgatgataacaacacagaagatccggtttggatt
cctattgttgctgctttacttctctttcttgtatttgctctggtagttgtatgttgtatc
attaagaagttttatccaattaagcgagaaggcaccaagttacccaaatccttgctgtct
gtggtaaaaaatgcctcttcagaggcaaaatttgattcaaaaattatatcacccatcacc
taccagccaattgccgtagaaaatgagcagctgtccccagggaccatttcaagcctgcac
actgaggacaatccaggaaaagtggaacacggagatctttctagtgaaatggaagtggtg
accattgaagaaaatatttctgacttggccccatgtagtcctctgaccccagagagagag
gattctatccacgcaagcagcaaccagtctgaatcctgcagcatcactttgaatgcgtat
cactccagaaatggctctgatagtggcctggcggtgtcagacaactgctccagctcagaa
tttcccccaagtaataaaactgaagtaaagactgaaggacaagacttcataacgctgaga
aacaccaccacctcctttggttatgataaaccgcatgtgttagtggatctgcttgtggat
gaaggtggtaaagagtccttaattggttacagacttaccgcagactccagagagttttca
tga

KEGG   Bos indicus (zebu cattle): 109567895
Entry
109567895         CDS       T04792                                 

Gene name
IL15RA
Definition
(RefSeq) interleukin-15 receptor subunit alpha isoform X1
  KO
K05074  interleukin 15 receptor alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04672  Intestinal immune network for IgA production
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109567895 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109567895 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    109567895 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109567895 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109567895 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109567895 (IL15RA)
   04090 CD molecules [BR:biu04090]
    109567895 (IL15RA)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL2 receptor family
   109567895 (IL15RA)
CD molecules [BR:biu04090]
 Proteins
  109567895 (IL15RA)
SSDB
Motif
Pfam: Sushi Cadherin_C_2
Other DBs
NCBI-GeneID: 109567895
NCBI-ProteinID: XP_019828494
UniProt: A0A6P5CTF1
LinkDB
Position
13
AA seq 354 aa
MFLGKKDAARLRSASASARSRGTLGQAAPGARQVWAWTHRAGDQASHAGRQPSCHPASQA
RTGRRGAARSQAAQGPGLLSQSBRRTQARGGDRVEWKPGITCPTPTSVEHADIQVKSYSI
NSRERYVCNSGFKRKAGTSSLTQCVFNETAKVAHWTTPNLKCIRDPSLSHQRPPSTAXPT
GLTPEPESPTPSGKEPDLTSKSDTKVATRPATGPGSRLPSTAPPVGTTGVVSKETTYVPA
QTAAKAPEHTYPALQDTPGAYQNNPRVVTAAVSTVTVLFVVCLVFLLGRCLWSRRAHQTP
GVEMESMESVPMTTGADARGEDTEIHPHGLGGSGDAEASSGRSEGPALPQSERT
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgttcttggggaagaaagatgcagcaagactaagaagcgccagtgccagtgccaggagt
cggggaacgttgggtcaggcagctccgggtgcgcgccaggtctgggcctggacgcacagg
gcaggtgaccaagccagccacgccgggcgacagcccagttgtcacccagcgtcacaggcc
cggactggcaggcgtggggccgctcgttcgcaggcagcccaaggtccaggccttctaagt
cagagcracagacgcacacaagccaggggaggtgaccgagtggagtggaagccaggcatc
acctgcccgactcccacatccgtggagcatgcagacatccaggtcaagagttacagcatc
aactccagggagcggtatgtttgtaattctggcttcaagcgtaaagctgggacctccagc
ttgacccagtgtgtgtttaacgagaccgcgaaagtcgcccactggaccactcccaacctc
aagtgcatcagagacccctccctgagtcaccaaaggccaccctccacagcagygccgaca
gggttgaccccagagccagagagccccaccccctccggaaaagagccagatcttacttcc
aagtcagacaccaaagtggccacaaggccagctactggaccaggctccaggctgccatcc
acagctcctcctgtgggaaccacaggggtagtcagtaaggagaccacctacgtcccagct
cagacagcagccaaggctccggaacacacatacccggccttgcaggacacgcccggtgca
tatcagaacaatcccagagttgtgaccgcagccgtctcaactgtcaccgtgctctttgta
gtatgcctggtgtttcttctgggacgttgcctgtggtcaaggcgagcccaccagacaccc
ggtgttgagatggagagcatggagagtgtgccaatgaccacgggggccgatgccagaggg
gaggacacggaaatccacccgcatggcctaggaggctccggggacgctgaggccagcagc
ggccgcagtgaaggcccagctcttccccagtcagagaggacctag

KEGG   Bos indicus (zebu cattle): 109567961
Entry
109567961         CDS       T04792                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04144  Endocytosis
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109567961 (IL2RA)
   04151 PI3K-Akt signaling pathway
    109567961 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109567961 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109567961 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109567961 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109567961 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    109567961 (IL2RA)
   04659 Th17 cell differentiation
    109567961 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109567961 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109567961 (IL2RA)
   05162 Measles
    109567961 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109567961 (IL2RA)
   04090 CD molecules [BR:biu04090]
    109567961 (IL2RA)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL2 receptor family
   109567961 (IL2RA)
CD molecules [BR:biu04090]
 Proteins
  109567961 (IL2RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 109567961
NCBI-ProteinID: XP_019828629
UniProt: A0A6P5CTU9
LinkDB
Position
13
AA seq 275 aa
MEPSLLMWRFFVFIMVPGCVTEACHDDPPSLRNAMFKVFRYEVGTMINCDCKTGFRRVSA
VMRCVGDSSHSAWENRCFCNSTSPAKNPVKQVTPAPEEQREKKPTDAQNQTQPPEEADLP
GHCEEPPPWEHEREPLKRVYHFTLGQTVHYQCAQGFRALQTSPAESTCMMINGELRWTRP
RLKCIREGEHGQASDDAEPQESTEAPPGSGTFLPTRMAGTTDFQKPTDEIATLDTFIFTT
EYQIAVAGCTLLLASILLLSCLTWQRKWKKNRRTI
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagccaagcttgctgatgtggaggttcttcgtattcatcatggtacctggctgcgtg
acagargcttgtcatgatgaccctccgagtctcagaaacgccatgttcaaggtcttcagg
tacgaggtgggcaccatgataaactgcgactgcaagacaggcttccgcagagtgtcggcc
gtcatgcgctgcgtgggggactccagccactctgcctgggaaaacagatgcttctgcaac
agcactagccctgctaagaacccagtaaaacaagtcactcctgcacccgaagaacagagg
gagaaaaaacccacagatgcgcagaaccaaacgcagcctccggaggaagctgaccttcca
ggtcactgtgaggaaccgccaccatgggaacacgaacgtgaacctttaaagagagtctac
catttcacgctggggcagacggttcattaccagtgcgcccagggattcagggccctacag
accagtcctgctgaaagcacctgcatgatgatcaacggggagctgaggtggaccaggccc
aggctcaagtgcatacgtgaaggggagcacggtcaggcttcagatgacgcagagcctcag
gagagcacggaagctccccctgggagtggaactttcttaccaaccaggatggcagggacc
acagatttccagaagcccacagatgagattgcaacgctggatacgttcatatttaccact
gagtaccagattgcagtggccggctgcaccctcctgctcgccagcatcctcctcctgagc
tgcctcacctggcagcggaaatggaagaagaacagaaggacaatatag

KEGG   Bos indicus (zebu cattle): 109568669
Entry
109568669         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: granulocyte-macrophage colony-stimulating factor receptor subunit alpha-like
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109568669
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109568669
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109568669
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109568669
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109568669
   04090 CD molecules [BR:biu04090]
    109568669
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL3 receptor family
   109568669
CD molecules [BR:biu04090]
 Proteins
  109568669
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind
Other DBs
NCBI-GeneID: 109568669
NCBI-ProteinID: XP_019829646
UniProt: A0A6P5CUA1
LinkDB
Position
14
AA seq 362 aa
MVLDSAWLLTQEQQDLPTVKPNASLNVKFDPQTTKLTWDCRENASSGECVLIHKEKGXIK
KKVKDSECQCTFQDYSLHGGVTLTVEVHVNQRRLSEMLVYTNPGREGTAAQNFSCVIYDA
DFMNCSWAKGRAAPDDVQYFLYIRSKKRIERECPRYLKDSGTHVGCHLXDLSGLTSYXYF
LVNGTSQETGIQFFDSVLLLKEIEQYNPPDNITVQCNESHCLIRWEKPRTRQPWPNREFQ
YQLDIQRRRDTSSSRSQLIVVFGDSGNRYNFPKPGSKAKHTVKIRTADARKAHWGAWSQP
VEFXFLKSHRLFPPVPQIKDKLNDNHQVDHEMLWEKFTHETGKSDKEEVLTVETVSEAPA
KL
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggtgcttgactcygcatggctcctcacccaggagcagcaggatcttccaaccgtgaag
ccaaacgccagcctaaatgtgaagtttgacccacagacgacgaagctgacttgggactgc
agggaaaacgctagctctggggaatgtgtgctgattcacaaggagaaggggcygattaag
aaaaaggtcaaagacagtgagtgtcagtgcacgtttcaggactattctctccacggggga
gtcacgcttaccgttgaagtacatgtcaaccagagacggctttcagaaatgctggtctac
actaacccaggtagggagggcacggctgcccaaaacttctcctgtgttatctacgacgcg
gatttcatgaactgcagctgggccaagggccgagcggctcccgacgacgtccagtacttt
ctgtacatccgatcaaagaaaagaatcgagagggaatgtcctcgttacctgaaggactcg
gggacccacgtgggatgtcacctccragacctctcgggattaacgtcgtacarttacttc
ctggttaacggtaccagccaagaaaccggaatccagttcttcgactcggttttgctgtta
aaggaaatagagcagtacaacccacctgacaacatcaccgtccagtgcaacgagtcccac
tgcctcatcaggtgggaaaagcccaggacccgacagccatggcccaacagggagttccag
taccagctggacatccagagacggcgcgataccagcagcagtagaagtcaactgattgta
gtatttggtgactccggtaatagatacaactttccgaaaccgggatccaaagcgaaacat
actgtgaagatcaggacagcggacgcccggaaagcccactggggagcctggagccagccc
gttgagttcngattcctcaagagccacaggttattccctccrgttccacagatcaaagat
aaattgaatgataaccatcaagtcgaccacgagatgctatgggagaagtttacacacgaa
acgggaaaaagtgacaaggaagaggtcttaaccgtggagacagtctcagaagccccagcg
aaactgtga

KEGG   Bos indicus (zebu cattle): 109569763
Entry
109569763         CDS       T04792                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04066  HIF-1 signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05164  Influenza A
biu05168  Herpes simplex virus 1 infection
biu05200  Pathways in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109569763 (IFNGR2)
   04066 HIF-1 signaling pathway
    109569763 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109569763 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109569763 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109569763 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    109569763 (IFNGR2)
   04659 Th17 cell differentiation
    109569763 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109569763 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109569763 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109569763 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109569763 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109569763 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    109569763 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    109569763 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109569763 (IFNGR2)
   05140 Leishmaniasis
    109569763 (IFNGR2)
   05142 Chagas disease
    109569763 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109569763 (IFNGR2)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IFN receptor family
   109569763 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 Pur_ac_phosph_N UL73_N
Other DBs
NCBI-GeneID: 109569763
NCBI-ProteinID: XP_019831409
UniProt: A0A6P5D203
LinkDB
Position
1
AA seq 371 aa
MRPPPPTLLPPLLLMLSGFGAAAPPADSLAQLPAPGNLKVHLYNAQQALSWEPVSLDSDP
RPVVYQVQYKYSTSSNWYDVNKEDSKVDCTNLTGTECDFTANSLSEGFPRRFNISLRVRA
KLGGLVSAWATAPWFEHYRNATIGPPENIRVTPEEGSLIIRLSAPFDVPATEAYFVYCVY
YWEKAGAKQVTRPFRSNFITLNDLKPLRVYCFQVKAELFLTKENISRPGHLSNISCCETA
ADASVKLQQDFLAAGTTFLVLSVVVGSCLFLVLRYRGLVKHWFHSPPXIPSQIEEYLKDP
AQPILDALDKDSSPKDDTWDSVSVVTFPENEQEGSPQSTLNQSAGPSHQPTEGVLCAKEA
ATCLSGLDGAT
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgcggccgccgccgccgacactgctgccgccgctgcttctgatgctcagcggctttggc
gctgcggcgccccccgcagactccctggcccagctgcctgctcctggaaacctgaaggtt
cacctgtacaacgcccagcaggcgctgagctgggagccggtgtccctggacagcgacccg
aggccggtggtctaccaggtgcagtataaatacagcaccagtagtaactggtatgatgtc
aacaaagaagatagcaaggtggattgtacgaacctcaccgggacagagtgtgactttacc
gcaaacagcctctcggaggggttcccacggcgtttcaacatctctttacgtgttcgagct
aagctcgggggcctcgtttctgcctgggcaacagcaccttggttcgaacactatcggaat
gctaccattgggcctccagaaaacatccgggtgaccccagaagaaggctcccttatcatc
aggctttctgctcccttcgatgtccctgccaccgaggcctattttgtgtattgtgtctac
tactgggagaaggcaggagctaaacaggtgacacgcccgttcaggagtaacttcatcaca
ttgaatgatttaaaacccttaagagtatactgttttcaagtcaaggcagaactgtttttg
accaaagaaaacatctctcgacctggacatttaagcaacatatcttgctgtgaaacggca
gcagatgcttctgtcaagcttcaacaagacttcctggctgccggaaccacctttttggtg
ctgtcagtggtggtagggtcctgtctcttcctggttctgagatacagaggcctggttaaa
cactggttccactctccgccrmgcattccatcacagatagaggagtatttaaaggatccg
gctcagcccatcttagacgccctggacaaggacagctcgccaaaggatgacacttgggac
tccgtgtcggtcgtgacgtttccagagaatgagcaagaagggagtccccaragcactttg
aaccaaagtgctggtccaagccaccagcccacggaaggagttctctgtgccaaggaagct
gcgacatgcctgtcaggactggatggagccacttga

KEGG   Bos indicus (zebu cattle): 109569863
Entry
109569863         CDS       T04792                                 

Gene name
IL10RA
Definition
(RefSeq) interleukin-10 receptor subunit alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04630  JAK-STAT signaling pathway
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109569863 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109569863 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109569863 (IL10RA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109569863 (IL10RA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109569863 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109569863 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109569863 (IL10RA)
   04090 CD molecules [BR:biu04090]
    109569863 (IL10RA)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL10/28 receptor family
   109569863 (IL10RA)
CD molecules [BR:biu04090]
 Proteins
  109569863 (IL10RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 109569863
NCBI-ProteinID: XP_019831180
UniProt: A0A6P5CZV8
LinkDB
Position
15
AA seq 580 aa
MLSHQIVKLVALLSLLLGSRAHELPRPPSAWFEAEFFHHVLYWTPIPNQSESTYYEVELL
RYGVEPTSWKSIQRCSQMLMMSCDVTMETLDLYRSNGYRARVRAVDGSQHSNWTSPNTRF
SMDEVTLTVASVKLEVHNSNIVGAIQLPRPEVAPEGDTYENIFHNFREYQIEVRKAPGHY
ESHGKVKNESFKLPIPRGVGEFCVRVKPSVGSRVNKEVWSKEECILLTSQYFTVTNISIF
LTFVLLLYGALAFCLTFQLYVRRRGKLPAVLVFKKPSPFNLISQFSHPETQDTVHTLDEE
AFPKVTPELRNSDMHGSTDSGFGSAKPSLQTEEPQFLLPASDPQAGGTLEKGMPQELENS
CGSAGSSNSADSGICLPDPRLCPGTEPSWEPQVGSDSRDREDSGIGLVQNSRGQPEDAQG
GSASGHVSPLGPEEPVEEDSVAGAFQGYLKQTQCPEEKAAQAGGLEEESSSTEDLDPQFR
TCLDTEAGWPLPALAKGYVQQDPPEMILAPLQTPEEQWDRPTEDWSFLGLTSCGDLGTSD
WSFAHDLAPLDCVPAPGGLLGSFDSDLVTLPLITSLQSNE
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgctgtcgcaccagatagtgaagctggtggcgctcctcagcctgctcctcggctctcgc
gcgcacgaactgcccagacctccatctgcgtggtttgaagcagagtttttccaccacgtc
ctctactggacacccattccaaatcagtctgaaagtacctattatgaagtggaactcctg
aggtatggagtagagcccacctcctggaagtccatccagaggtgtagccagatgctgatg
atgtcctgtgatgtcactatggagaccctggacctgtatcgcagcaatggttaccgggcc
agagtccgggcagtggacggaagccagcattccaactggacctctcctaacacccgcttc
tccatggatgaagtgactctgacggttgccagcgtgaagctcgaggtgcacaacagtaac
atcgttggggccatccagctccccaggcccgaggtggcccctgaaggcgacacgtatgaa
aacatcttccacaatttccgggagtaccagattgaggttcgcaaggcaccaggacactat
gagtcccatggcaaggtcaaaaacgaaagcttcaaactcccaatcccgagaggggtggga
gagttctgcgtcagggtgaaaccgtctgtgggctcccgagtaaacaaggaggtctggtcc
aaggaggagtgcatcctgctcacctcgcagtatttcacagtgaccaacatcagcatcttt
ctcaccttcgtcctgctgctctatggagccctggccttctgtctgaccttccagctgtat
gtgcggcgccgggggaagctgcctgctgtcctggtcttcaagaagcccagtcccttcaac
ctcatcagccagttttcccacccagagacccaagataccgtccacaccctggatgaggag
gccttccccaaggtgactccggagctgaggaactcagacatgcacggcagcaccgacagt
ggcttcggcagtgccaagccgtcgctgcagaccgaggagccccagttcctcctccctgcc
tccgacccccaggccggggggactctggaaaaggggatgccccaggagttggagaacagc
tgtggtagtgcaggtagtagcaacagtgcagacagcgggatctgcttgccagatccccgc
ctgtgtcccggcacggagcccagctgggagccacaggtggggagcgacagccgggaccgg
gaggacagtggcattggcctggtccagaactctaggggacagcctgaggatgctcagggt
ggctcagcctcaggccatgtgagtcccctgggacctgaggarcctgtggaagaagactca
gtggcaggggccttccagggctacctgaagcagacccagtgcccagaggagaaggcagcc
caggcaggcggcctggaagaagagtcttcctcaacagaggaccttgacccccaattcagg
acgtgcctggatactgaggcgggctggcctctaccagccctggccaagggctatgtgcaa
caggaccccccagaaatgattcttgctcctttgcagacccctgaagaacagtgggaccga
ccaactgaggactggtcatttctgggcttgaccagctgtggcgacctcggcacatctgac
tggagctttgcccatgaccttgcccctctggattgtgtgccggccccgggcggtctcctg
ggcagttttgactcagacctggtcaccctgccactgatcaccagcctgcagtcaaatgag
tga

KEGG   Bos indicus (zebu cattle): 109570535
Entry
109570535         CDS       T04792                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109570535 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    109570535 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109570535 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109570535 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109570535 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    109570535 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    109570535 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109570535 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570535 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109570535 (IFNAR1)
   05160 Hepatitis C
    109570535 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    109570535 (IFNAR1)
   05164 Influenza A
    109570535 (IFNAR1)
   05162 Measles
    109570535 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    109570535 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109570535 (IFNAR1)
   05169 Epstein-Barr virus infection
    109570535 (IFNAR1)
   05165 Human papillomavirus infection
    109570535 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109570535 (IFNAR1)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IFN receptor family
   109570535 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 CHASE5
Other DBs
NCBI-GeneID: 109570535
NCBI-ProteinID: XP_019832517
UniProt: A0A6P5D6F6
LinkDB
Position
1
AA seq 560 aa
MLALLGATTLMLVAGRWVLPAASGEANLKPENVEIHIIDDNFFLKWNSSSESVKNVTFSA
DYQILGTDNWKKLSGCQHITSTKCNFSSVELENVFEKIELRIRAEEGNNTSTWYEVEPFV
PFLEAQIGPPDVHLEAEDKAIILSISPPGTKDSIMWAMDRSSFRYSVVIWKNSSSLEERT
ETVYPEDKIYKLSPEITYCLKVKAELRLQSRVGCYSPVYCINTTERHKVPSPENIQINAD
NQIYVLKWDYPYENATFQAQWLRAFFKKIPGNHSDKWKQIPNCENVTSTHCVFPREVSSR
GIYYVRVRASNGNGTSFWSEEKEFNTEMKTIIFPPVISVKSVTDDSLHVSVGASEESENM
SVNQLYPLIYEVIFWENTSNAERKVLEKRTNFIFPDLKPLTVYCVKARALIEBDRRNKGS
SFSDTVCEKTKPGNTSKTWLIVGTCTALFSIPVVIYVVSVFLRCVKYVFFPSSKPPSSVD
EYFSDQPLRNLLLSTSEEQTERCFIIENASIITEIEETDEIDEVHKKYSSQTSQDSGNYS
NEDENSGSKISEEFPQQDSV
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgctcgctctcctgggcgcgacgaccctgatgctggtcgctgggagatgggtgctgccc
gccgcctcaggggaagcaaatctgaagcctgaaaatgtcgagatccacatcattgatgac
aattttttcctgaagtggaacagcagcagtgagtctgtcaagaatgtgactttttcagca
gattatcaaatactaggaacggataactggaagaaattgtctgggtgtcaacatattact
agtaccaaatgcaacttttcttcagtcgagcttgaaaatgtttttgaaaaaattgaattg
cgcataagagcagaagaaggaaacaacacttccacatggtatgaggttgagccatttgta
ccatttctagaagctcagattggtcccccagatgtgcatttagaagctgaagataaggca
ataatactgagtatctctccccctggaacaaaagatagtatcatgtgggctatggatcgt
tcaagctttaggtatagcgtcgttatctggaaaaactcttcaagtctagaagaaagaacg
gaaactgtttatcccgaagataaaatttataaactgtcaccagagattacttattgttta
aaagttaaagcagaactgcgtttacaaagtagagttggttgctatagtccagtgtattgt
ataaataccacagagagacataaagtaccttcaccagaaaatatacaaatcaatgctgac
aaccagatctatgttcttaagtgggattacccatatgaaaacgcaacttttcaagctcag
tggctccgtgccttttttaaaaagattcctgggaatcattcagacaaatggaaacaaata
ccgaactgtgaaaatgtcacaagtacccactgtgtctttcctcgagaggtttcctcaagg
ggaatttactatgtccgtgtacgagcatctaatggaaatggtacctctttttggtctgaa
gagaaggaatttaatactgaaatgaaaactatcatatttcctccagtcatcagcgtgaaa
tccgttactgatgattcactgcatgtcagtgttggtgcttcagaagagtctgaaaacatg
tctgtgaatcagctctacccgctaatttatgaagtaattttttgggaaaacacttcaaat
gctgagagaaaagttctagagaaaagaaccaattttatctttcctgacttgaaaccgctg
actgtgtattgtgtcaaagccagagcactcattgaaratgacaggcggaataaagggagc
agttttagtgatactgtgtgtgagaaaacaaaaccaggaaatacttccaaaacctggctt
atagttggaacttgcactgcattgttttctattcctgtggtcatttatgttgtgagcgtc
ttcttgagatgtgtcaagtatgtgttctttccatcaagtaaacctccttcctctgttgac
gagtatttctccgatcagccactaaggaatctactcctttccacttctgaggaacaaacg
gaaagatgttttataattgaaaatgcaagcattattactgaaatagaagagactgatgaa
attgatgaagttcacaaaaagtacagttcccaaactagtcaagattcaggaaactattca
aacgaagatgaaaacagtggaagcaaaataagcgaagagtttccgcaacaggacagtgtg
tga

KEGG   Bos indicus (zebu cattle): 109571300
Entry
109571300         CDS       T04792                                 

Gene name
IL10RB
Definition
(RefSeq) interleukin-10 receptor subunit beta isoform X1
  KO
K05135  interleukin 10 receptor beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04630  JAK-STAT signaling pathway
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109571300 (IL10RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109571300 (IL10RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109571300 (IL10RB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109571300 (IL10RB)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109571300 (IL10RB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109571300 (IL10RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109571300 (IL10RB)
   04090 CD molecules [BR:biu04090]
    109571300 (IL10RB)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL10/28 receptor family
   109571300 (IL10RB)
CD molecules [BR:biu04090]
 Proteins
  109571300 (IL10RB)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac Adeno_E3_CR2
Other DBs
NCBI-GeneID: 109571300
NCBI-ProteinID: XP_019833631
UniProt: A0A6P5D5P8
LinkDB
Position
1
AA seq 304 aa
MFTALGMVPPPENVRMNSVNFKNILRWESPAFPKGNLTFTAQYQSYRKFQDTCTSILLTE
CDFSSLSKYGDHTLRVRAEFADESSEWINITFCPVDDTTIGPPRMQVEALANSLHVRFFA
PRIENEPEPWTMRNIYNSWTYHVQYWKNGSDEKFLISGQYDFEFLRNLESQTTYCVRVRG
FLSDRNKAGEWSEPVCEQTTIDETTPSWMVASVLAASVCAALLLLLGCFFLLRCVYRKAR
HAFPPRNSLPQHLKEFMSHPHHSTLLLFSFPLSDENEVFDKLSVITEVSESCKLNPGAGC
GLTT
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtttacagcattaggaatggttccacctcctgaaaatgtcagaatgaattcagttaat
ttcaagaatattctacgatgggagtcacctgcttttcccaaggggaatctgacgttcaca
gctcagtaccaaagttacaggaaattccaagatacatgcacgagtattttgttgacggaa
tgcgatttctcaagtctttccaagtatggtgaccacaccttgagagtcagggctgaattt
gctgatgagagttcagagtggataaacatcaccttctgtcctgtggatgacaccactatc
ggacctcccagaatgcaagtagaagcacttgctaattctttacatgtgcgtttctttgcc
ccaagaatcgagaatgaacctgaaccgtggaccatgaggaacatttataactcatggact
taccatgtgcaatattggaaaaatggctctgatgaaaagtttttaatttctggtcagtat
gacttcgagttcctccgaaatcttgagtcacagacaacttattgtgttcgagttcgaggg
tttctttctgatcggaacaaagctggagaatggagtgagcctgtctgcgagcaaacaacc
attgacgaaaccaccccgtcctggatggtggccagcgtcctggcagcctccgtgtgcgcc
gctctcctgctactgctcggctgcttcttcctgctgcggtgtgtttacaggaaggcaagg
cacgccttccccccgaggaattctcttccgcagcacctgaaagagtttatgagccaccct
catcacagcactcttctcttattctccttcccactgtctgatgagaatgaagtctttgac
aaactgagcgtcatcacagaagtgtctgaaagctgcaagctgaaccctggggccggctgc
ggtctcacgacctga

KEGG   Bos indicus (zebu cattle): 109572614
Entry
109572614         CDS       T04792                                 

Definition
(RefSeq) interferon alpha/beta receptor 2 isoform X1
  KO
K05131  interferon receptor 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05160  Hepatitis C
biu05162  Measles
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109572614
   04151 PI3K-Akt signaling pathway
    109572614
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109572614
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109572614
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109572614
   04621 NOD-like receptor signaling pathway
    109572614
   04650 Natural killer cell mediated cytotoxicity
    109572614
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109572614
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109572614
  09172 Infectious disease: viral
   05160 Hepatitis C
    109572614
   05171 Coronavirus disease - COVID-19
    109572614
   05164 Influenza A
    109572614
   05162 Measles
    109572614
   05168 Herpes simplex virus 1 infection
    109572614
   05167 Kaposi sarcoma-associated herpesvirus infection
    109572614
   05169 Epstein-Barr virus infection
    109572614
   05165 Human papillomavirus infection
    109572614
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109572614
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IFN receptor family
   109572614
SSDB
Motif
Pfam: Tissue_fac Interfer-bind Pox_A6 Uroplakin_II
Other DBs
NCBI-GeneID: 109572614
NCBI-ProteinID: XP_019835518
UniProt: A0A6P5DFM9
LinkDB
Position
1
AA seq 530 aa
MLLSQNVSAIGPLNLYPMVHISLVFGISYVAPVLSDEHCTLKMRFRNFQSVLSWELKNHS
IVPTHYTLWYTIMSKREDMKVVKDCINVTRSFCDLTDVWVNTTDMYIPQVVGFRENAKLV
ICMGSFFLAPDKPLDPPEFEIVGFTNHISVNVKFQFDSPGILSEELQFYLAFIEEHAGNS
VKRHQPQITGNITKNFNYVIDKLIPNTNYCISVYFEPKDPRKINRSPLKCTLFRPRRESE
SSESATIGGIITLFLITAVFISTVMILKRIGYICLRNDFPKVLNFYKLSVWVFAELPPLE
KVATVEVIHVNRKKKVWNYNYDDENDIENEAAPHLISGGYTKHGLTGKLCPTSTTSPSLE
DCSLEDCSEPSAEEPYLPEPKGDAETPMAPXXXXXXXXXXXXXXXXXXXLWQDPTSEEDS
DSTEGSEGRIVFNVNLNSVCVRALEDDKDSEVTLMSPSCPEERVELEDLNETESSVLVAS
EEGTQLPFTNPSTECPRPQDAPSDKSDTSESDVDMGDGYIVRQVNLKKFN
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgcttttgagccagaatgtgtcagcgattggaccactgaatttgtatcccatggtgcac
atcagcctcgtgtttggtatttcgtatgttgcgcctgttctttcagatgaacattgcact
ttaaagatgagattccgaaatttccagtcagtcttatcatgggaattaaaaaaccattca
attgtaccaactcactatacattatggtacacaatcatgagtaaacgagaagatatgaag
gtcgtcaaggactgtataaacgtcacaagatcgttttgtgacctcacagacgtgtgggta
aacacgacggacatgtacatcccccaggtggttggattcagagagaatgcaaagctggtc
atttgtatgggctctttcttcctggcgccagacaagcctttggacccaccagagtttgag
attgttggttttacaaaccacatcagtgtgaatgtgaaatttcaattcgacagtcccggg
atactaagtgaagaattacagttttacttagcatttattgaagagcatgcagggaacagt
gttaagaggcatcaaccccaaataactggaaacatcaccaaaaatttcaattatgtcatc
gacaagttaattccaaacacaaactactgtatatccgtttattttgagcctaaagatcca
agaaaaataaacagatctcccttaaaatgtaccctctttcgacccagacgagaatcagag
tcatcagaatctgctacaataggaggaataattactctgtttttaataactgctgtcttc
ataagcactgtaatgatactgaaacggattggctatatatgcttaagaaatgatttcccc
aaagttttgaatttttataaactgtcagtctgggtgtttgccgagctgcccccgttggaa
aaagtggctaccgtggaagtcattcacgtcaacaggaagaagaaagtgtggaattataat
tatgacgatgaaaatgacatcgaaaatgaggcagctccccacttaatttcaggtggttac
accaagcatggactaacgggcaagctgtgtccaacttccaccacttcacccagcttggag
gactgcagcttggaggactgcagtgagcccagtgctgaggagccgtatctgcctgagccc
aagggggacgccgagacccccatggcaccttgnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnntctgtggcaggaccccacttccgaggaggacagt
gactccacggaggggtctgagggcagaatcgtcttcaacgtgaatttgaactctgtgtgt
gtaagagcccttgaggatgacaaggactcagaagtcactctaatgtccccatcttgtcca
gaagagagagtcgagctggaggacctcaacgagacagaatcaagcgttttggtggccagt
gaagaagggacacagctgcccttcaccaacccctctacggagtgcccgaggccccaagat
gctccttctgataaaagtgacacttccgagtcagatgttgacatgggggatgggtatata
gtaagacaagtgaatctaaaaaaatttaattaa

KEGG   Bos indicus (zebu cattle): 109573827
Entry
109573827         CDS       T04792                                 

Gene name
IFNLR1
Definition
(RefSeq) interferon lambda receptor 1
  KO
K05140  interferon lambda receptor 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109573827 (IFNLR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109573827 (IFNLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109573827 (IFNLR1)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL10/28 receptor family
   109573827 (IFNLR1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 109573827
NCBI-ProteinID: XP_019836865
UniProt: A0A6P5DHK7
LinkDB
Position
2
AA seq 524 aa
MTGARRWAPLLLCLLQSAPGRPLLAPPQNVTLLSRDFSVYLTWLPGPGNPQNVTYFVAYQ
SFAPPRRWRRVKKCAGTKELVCSLMCLEKQDLCNKFKGRVQAVSPSARSPWVESKFMDYF
FEVEPAPPVLVFNQTEEILIVNATYQLPHCLPQPDMNYEVNFWKEGTKNKTRFPDTRHGQ
PVQIPLQPDTSGHHCLSARTIYFFGNPKYSEFSEPTCFFLEAPGSNWALLLLLPFLLPLL
LAVAIGPVMWKTFRENPWFQQTKMPQALSFSGHRLCGATFQPGGPECLHDLIVCPQKEVT
RRVRLTSRVRAPAPVQARPEKDSXEEKDGEESTDEEDLDPGXSFQPYVEPPPFLGQEAQS
PGPTKAGEPWTPLVQGEGSSACSSSGRSWVSTAGSSSPWDEAGSSGYLAKKGPGQGMGRE
EHQKPLPPPKDSSSLGEPSKDNVSSWTSWGLSSPGLNLVPGEPPVSLRTLTFCWDSSPED
DEGEEEEEEEGWRESESEDSGAGSWGAKSLQRTEVRPLGHYLAR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgacgggggcccgacgctgggcccccctgctcctgtgtctgctgcagtccgctccaggg
cggcccctcctggcccctccccagaatgtgacgctgctctcccgggacttcagtgtgtac
ctgacgtggctcccagggcctggaaacccccagaacgtgacctattttgtggcctatcaa
agctttgcaccccccagacggtggcggagagtgaaaaagtgtgcaggaaccaaagagctg
gtgtgttctctgatgtgcctggagaagcaagacctgtgcaacaagttcaaggggcgtgtg
caagcagtttcacccagtgccaggtccccctgggtagagtccaagttcatggattacttc
tttgaagtggagccagccccacctgtcctggtgttcaaccagacagaggagattctgatt
gtcaatgctacataccagctgccgcattgtctgccccaaccagatatgaactatgaggtg
aatttctggaaggaagggactaagaacaagacccggtttccagacactcgccatggccag
ccagtccagattcctctccagccagacaccagtgggcaccactgcctcagcgccagaacc
atctacttctttggcaaccctaaatacagcgagttctccgagcctacctgcttcttcctg
gaggccccgggatccaactgggccctcttgttgctgctaccatttctgcttccactgctg
ttggctgttgccatagggcctgtgatgtggaagacmttcagggagaacccctggtttcag
cagacaaagatgccacaggccctgagcttctccggacacagactctgcggggcaaccttt
cagcccggtggcccagagtgcctgcacgacttgatcgtatgtccccaaaaggaagtgacc
agaagggtcaggctgacctctagagtcagggccccagcccccgtccaggccagaccagag
aaggacagcrctgaggagaaggacggtgaggagagcacagatgaagaggacctggatcct
ggcrtcagcttccagccctatgttgaaccgccgcccttcctggggcaggaagcccagagc
ccggggcccaccaaggcaggagagccctggactcctctggtccagggggaagggtcctct
gcctgcagttcttcaggcagaagctgggtcagcactgcggggtcctcctccccstgggat
gaggctggatcctcgggctatttggccaagaagggkccaggccaggggatgggtcgggag
gaacaccagaagcctctcccaccacccaaggactccagttccctgggagagccctccaaa
gacaacgtctcctcctggaccagctggggcttatcatcaccagggctgaatctagtccct
ggagaacccccagtttctcttcggacactgaccttctgctgggacagtagtcctgaggat
gatgagggggaggaagaagaggaggaagagggctggagggagtcagaaagtgaggacagc
ggtgctggcagctggggggctaagagcctccagaggaccgaggtcagacccttggggcat
tacttggccaggtga

KEGG   Bos indicus (zebu cattle): 109574806
Entry
109574806         CDS       T04792                                 

Gene name
LIFR
Definition
(RefSeq) leukemia inhibitory factor receptor isoform X1
  KO
K05058  leukemia inhibitory factor receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109574806 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109574806 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109574806 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109574806 (LIFR)
   04090 CD molecules [BR:biu04090]
    109574806 (LIFR)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL6/12 receptor family
   109574806 (LIFR)
CD molecules [BR:biu04090]
 Proteins
  109574806 (LIFR)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 Pur_ac_phosph_N IL6Ra-bind Sarcoglycan_2
Other DBs
NCBI-GeneID: 109574806
NCBI-ProteinID: XP_019838324
UniProt: A0A6P5DKN1
LinkDB
Position
20
AA seq 1095 aa
MMDISLCVKRPSWLVDRKRMRMASNSQWLLLTAVLLYLTNQVNSQKKSTPHDLKCVTNNL
KVWDCSWRALFGAGRAASYEVCIEKRSRTCYLLEKNTTIPPLLPGHYEITVHPLYEFGSS
KSKFILNEKNISLIPETPEILNLSADFSTSTLHLKWNDKGSVFPHYSNVIWEIKVLHKKN
MEIVKLVTYSTTLNGRDTIHHWNWTSDMPLECAIHYVGIRCYIDDPQFSGHKEWSDWSLL
KNISLPPDSQTKVFPQDKVILAGSDITVCCVTQEKVLSAQIGSTHCPLIHLDGENVAIRI
RNISASASSGTNVVFSVEDNIFGTVVFAGYPPDIPQKLNCETYDLKEIICTWNPGRPTSL
EGPRSTSYTLFESFSGKYVRFKGDEVSANENYQLFFQILSSQEIHNFTLNAQNLLGQTES
TLLVNITEKVHPRIPTSLKAKDINSTAVILSWHLPGNFTKVKLLCQIEINKTNSEHELRN
VTMRGVESSNYLTTVDKLNPYTIYTFRIRCSTDPFWKWSKWSNEKQCLTTEAIPSKGPDI
WREWSSDGRNLIIYWKPLPINEAYGKILSYNVSYSSDEETKSLSEIPDTQHRAELQLDKN
DYIISVVAKNSAGSSPPSKIASMEIPNDDLKIEQALGMGNRILLTWNYDPNMTCDYVIKW
CNSSQSGPCLMDWKKVPPNSTETVIESDQFRPGVRYNFSVYGCRNQGYQLLRSVIGYVEE
LAPAVAPNFTVEDTSADSILVKWEEIPVEELRGFLRGYLFYFEKGERDTSKIMGLEPGRF
DTKVKNITDISQKTLRIADLQGKTSYHLVLRAYTGGGMGPERSMFVVTKENSEGLIIAIL
IPVAVAVIIGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGNSALKTLEMN
PCTPNNVEVLETRSVALKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPVIEEELANP
GAEGGGASQVIYIDVQSMYQPQAKPEGELDSDPVGGAGYKPQMHLPVTSTVDDLDADDDL
DKTAGYRPQANVNTWNLVSPDSPRSTDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKSSG
GGWSFTNFFQNKPND
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgatggacatttctttatgtgtgaaacgaccatcctggctggtggaccgcaaaagaatg
aggatggcttcaaattcccagtggctcttattaacagctgtgcttctgtatttaacaaat
caagtaaacagccagaaaaaaagtactcctcatgatttgaagtgtgtaactaacaattta
aaagtgtgggactgttcttggagagcactttttggagcaggtcgtgctgcttcttatgaa
gtttgcattgaaaagcggtcccgtacttgttatctattggagaaaaatactacaatccca
cctcttttacctggtcattatgaaataacagtacacccattatatgagtttggaagttcc
aaaagtaaattcatactaaatgaaaaaaacatttccttaattccagaaactccagagatc
ttgaatttgtctgctgatttctcaacttctacgttacacctaaagtggaatgacaaaggt
tctgtttttccacattactcaaatgtcatctgggaaattaaagttctacataaaaagaat
atggaaattgtaaaattagtgacctacagcacaactctgaatggcagagatacaattcat
cattggaactggacttcagacatgcccttggagtgtgccattcactatgtggggattaga
tgctacattgacgatcctcagttctctggtcacaaagaatggagtgactggagcctactg
aagaacatctccttgcctcctgattctcagactaaggtttttcctcaagacaaagtgata
cttgcaggctcagatataacagtatgttgtgtgactcaagaaaaagtgttatcagcacag
attggcagtacacattgtccccttatccatcttgatggggaaaatgttgcaatcaggatt
cgcaatatttctgcttctgcaagtagtggaacaaatgtggttttctcagtagaagataac
atatttggaacagttgtttttgcgggatatccaccagacattcctcaaaaactgaactgt
gagacatatgatttaaaagaaatcatttgcacgtggaatccaggaagaccgacgtccttg
gagggcccacgcagtacaagttacactttatttgaaagtttttcaggaaaatatgttaga
tttaagggagatgaagtgtccgcaaatgaaaactaccagttattctttcaaatactttca
agtcaagaaatacacaattttacattgaatgctcaaaatcttctgggtcagacagaatca
acacttttagttaacataactgaaaaagttcatccccgtattcctacttcactcaaagct
aaggatattaattcaacagctgtgatactttcctggcatttaccgggcaactttacaaaa
gttaaactgttatgtcaaattgaaattaataaaactaactcagagcatgaattgcggaat
gtcacaatgaggggggtagaaagttcaaattatcttactactgtggacaagttaaatcca
tataccatatatacttttcggattcgttgttctactgaccctttctggaaatggagcaaa
tggagcaatgaaaaacagtgtttaaccacagaagccattccttcaaagggaccagatatt
tggagggagtggagttctgatggaagaaatctaataatatattggaagcctttacccatt
aatgaagcttatggaaaaatactttcttataatgtatcatattcatcagatgaggaaaca
aaatccctttctgagattcctgatactcaacacagggcagaattacaacttgataaaaat
gactacatcatcagtgtggtggcaaaaaattctgccggctcatcaccaccttctaaaata
gctagtatggaaattcccaatgatgatctcaaaatagagcaggctcttggaatgggaaat
aggatcctcctcacttggaattacgaccccaacatgacctgcgactatgtaattaagtgg
tgtaactcatctcagtctggaccctgcctcatggactggaaaaaagtccctccaaacagt
actgaaactgtaatagaatctgatcagtttcgaccaggtgtaagatataatttttcggtg
tatgggtgcagaaatcaaggatatcaattattacgttctgtaattggatatgtagaagaa
ttggctccagctgttgctccaaattttactgttgaggatacatctgcagattctatatta
gtgaaatgggaagaaattcctgtggaagagcttagaggatttttaagaggatatttattt
tactttgaaaaaggagagagagacacatctaagataatgggtttggaaccaggtcgtttt
gacacaaaggttaagaatattactgacatatcccagaagacactgaggattgctgatctt
caaggtaaaacaagttaccacctggtcttgcgagcctacacaggtggaggaatgggccca
gagaggagcatgtttgtggtgacaaaggaaaactctgagggtttgattattgccatcctc
atcccagtggcagtggctgtcatcattggagtggtaacaagtatcctttgctatcggaaa
cgagaatggattaaagaaaccttctatcctgatattccaaatccagaaaattgtaaagct
ttacagtttcaaaagagtgtctgtgagggaaacagtgctcttaaaacattggaaatgaat
ccttgtaccccaaataatgtcgaggttctggaaactcggtcagtggctcttaaaatagaa
gatacagagataatttctccggtggctgagcgtccagaagatcgctctgacgcagaaccg
gagaaccatgtggttgtgtcctattgcccacccgtcatcgaggaagagctagcgaacccg
ggagcagaaggcggcggggcctcacaagtcatctacattgacgtccagtccatgtaccag
cctcaggcgaaaccagagggggagctggacagtgaccctgtagggggagcaggctataag
ccgcagatgcacctccccgttacttccactgtagacgatctggatgcagatgatgactta
gataaaactgcaggttacagacctcaggcaaacgtaaacacttggaacttggtatctcca
gactcacctcggtccacagacagcaatagtgagattgtgtcttttggaagtccgtgctcc
attaactcccgacaatttttgattccgcctaaagatgaagattctcctaaatcaagtgga
ggcggatggtcctttacaaacttttttcagaacaaaccgaatgattaa

KEGG   Bos indicus (zebu cattle): 109574810
Entry
109574810         CDS       T04792                                 

Gene name
GHR
Definition
(RefSeq) growth hormone receptor isoform X1
  KO
K05080  growth hormone receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109574810 (GHR)
   04151 PI3K-Akt signaling pathway
    109574810 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109574810 (GHR)
   04060 Cytokine-cytokine receptor interaction
    109574810 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    109574810 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109574810 (GHR)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  Prolactin receptor family
   109574810 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 109574810
NCBI-ProteinID: XP_019838333
UniProt: A0A6P5DJD5
LinkDB
Position
20
AA seq 641 aa
MIAGPTGMDLWQLLLTLAVAGSSDAFSGSEATPAFLVRASQSLQILYPVLETNSSGNPKF
TKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEWKECPDYVSAGENSCYFNSS
YTSVWTPYCIKLTSNGGIVDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIHADILVKWEP
PPNTDVKMGWIILEYELHYKELNETQWKMMDPLMVTSVPMYSLRLDKEYEVRVRTRQRNT
EKYGKFSEVLLITFPQMNPSACEEDFQFPWFLIIIFGILGLAVTLFLLIFSKQQRIKMLI
LPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKHEFYNDDSWVEFIELDIDDPDEKT
EGSDTDRLLSNDHEKSLNIFGAKDDDSGRTSCYEPDILEADFHVSDMCDGTSEVAQPQRL
KGEADISCLDQKNQNNSPSNDAAPAXQQPSVILVEENKPRPLLIGGTESTHQAVHTQLSN
PSSLANIDFYAQVSDITPAGNVVLSPGQKNKTGNPQCDTHPEVVTXCQANFIVDNAYFCE
VDAKKYIALAPHVEAESHVEPSFNQEDIYITTESLTTTAGRSGTAEHVPSSEIPVPDYTS
IHIVQSPQGLVLNATALPLPDKEFLSSCGYVSTDQLNKIMP
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgattgcaggtcctacaggtatggatctctggcagctgctgttgaccttggcagtggca
ggctccagtgatgctttttctgggagtgaagccacaccagctttccttgtcagagcatct
cagagtctgcagatactatatccagtcctagagacaaattcttctgggaatcctaaattc
accaagtgccgttcacctgaactggagactttctcatgtcactggacagatggggctaat
cacagtttacagagcccaggatctgtacagatgttctatatcagaagggacattcaagaa
tggaaagaatgccccgattatgtctctgctggtgaaaacagctgttactttaattcgtct
tatacctccgtgtggaccccctactgcatcaagctaactagcaatggcggtattgtggat
cataagtgtttctctgttgaggacatagtacaaccagatccacccgttggcctcaactgg
actctactgaacatcagtttgacggagattcatgccgacatcctagtgaaatgggaacca
ccacccaatacagatgttaagatgggatggataatcctggagtatgaactgcactataaa
gaactaaatgagacccagtggaaaatgatggaccctttaatggtaacatcagttccgatg
tactcgttgagactggataaagagtatgaagtgcgtgtgagaaccagacaacgaaacact
gaaaaatatggcaagttcagtgaggtgctcctgataacatttcctcagatgaacccatct
gcatgtgaagaagatttccagtttccatggttcttaattattatctttggaatacttggg
ctagcagtgacattatttttactcatattttctaaacagcaaaggattaagatgctgatt
ctacccccagttccagttccaaagattaaaggaattgatccagatctcctcaaggaagga
aaattagaagaggtgaatacaatcttagccattcatgacaactataaacacgaattctac
aatgatgactcttgggttgaatttattgaactagatattgatgaccctgatgaaaagact
gaagggtcagacacagacagacttctgagcaatgaycatgaaaaatcactcaatatcttt
ggggcaaaggatgaygactctgggcgtaccagctgctatgaacctgacattctggaggct
gatttccatgtcagtgacatgtgcgatggtacctcagaggttgctcagccacaaaggtta
aaaggggaagcagatatctcatgccttgatcagaagaatcaaaataattcaccttctaat
gatgctgcccctgctarccagcagcccagtgttatcctagtagaggaaaacaaaccaaga
ccacttctcattggtggaactgagtcaactcatcaagctgtccatacacagctcagcaat
ccaagttcwttggcaaacattgatttttatgcccaggtaagcgacattacaccagcagga
aatgtggtcctttccccaggccaaaagaataagactgggaacccccagtgtgacacgcac
ccagaagtggtcacaycctgccaagctaacttcatygtggacaacgcttacttctgcgag
gtagacgccaaaaagtacattgccctggcccctcacgtcgaggctgaatcacacgtagag
ccaagctttaaccaggaagacatttacatcaccacagaaagccttaccactacagctggg
aggtcggggacagcagaacatgttccaagttctgagatacctgtcccagattatacctcc
attcatatagtacagtctccacagggcctcgtactcaatgcgactgccctgcccttgcct
gacaaagagtttctctcatcatgtggctatgtgagcacagaccaactgaacaaaatcatg
ccatag

KEGG   Bos indicus (zebu cattle): 109574817
Entry
109574817         CDS       T04792                                 

Gene name
IL6ST
Definition
(RefSeq) interleukin-6 receptor subunit beta
  KO
K05060  interleukin 6 signal transducer
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04630  JAK-STAT signaling pathway
biu04659  Th17 cell differentiation
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109574817 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109574817 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109574817 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109574817 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109574817 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574817 (IL6ST)
   05203 Viral carcinogenesis
    109574817 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    109574817 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109574817 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109574817 (IL6ST)
   04090 CD molecules [BR:biu04090]
    109574817 (IL6ST)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL6/12 receptor family
   109574817 (IL6ST)
CD molecules [BR:biu04090]
 Proteins
  109574817 (IL6ST)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind Pur_ac_phosph_N Interfer-bind fn3_2 ObR_Ig SusE
Other DBs
NCBI-GeneID: 109574817
NCBI-ProteinID: XP_019838346
UniProt: A0A6P5DJQ6
LinkDB
Position
20
AA seq 918 aa
MFTLQTWIVQALFIFLTTESIGELIVPCAHIHPESSVVQLGSBFTAVCVLKEKCMDDYHV
TANDIFWKTGRVPVPYEQYSVINRTASSVTFPNITLINALLTCNIRMFGQINRSVYGIRI
ISGLPPEKPKNLSCIVNEGKKMMCQWDPGRETYLETNYTLKSEWATEKFDDCKAKRDTPT
SCTVDYPPVYFVNIEVWVEAENALGKVTSDHINFDPVDKVKLNPPHILSVNSSKELSSIL
KLTWTDSRFKSFITLKYDIQYRTKDASTWNQVPPEDTSSTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPNFWYKIEPSHAHGTRSIQLKWKTLPPFEAN
GKILDYEVTLTKWKSHSQNYTVKDTKLTVNLTNDRYVATLTARNLVGKSDASVLTIPAWD
FQATHPITDLKAFPKDNVLWVEWTAPNESVNRYILEWCVLSDKSPCIPDWQQEDGTVHRT
YLRGNLVESKCYLITVTPVYDDGPGSPEHIKAYLKQAAPSRGPTVRTKKVGKNEAVLEWD
HLPIDVQNGFIRNYTIFYRTVIGNEIAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHFNSKDQMYPDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKVNT
EGHSSGIGGSSCMSSSRPSISSSDENESAQNTSSTVQYSTVVHSGYRHQVPSVQVFSRSE
STQPLLDSEERPEDLQLVDNVDGSDGILPRQRYFKQNCSQHETSPDISHFERSQQVSSVN
EEDFVRLKQQQISDHISQPYGSGKMKMFQEVPAVDAFGPGIEGQVERFETVGMEDAVDEG
MPKSYLPQTVRRGGYMPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgttcacattgcaaacttggatagtgcaagccttgtttattttcctcaccactgaatct
ataggtgaacttatagttccatgtgctcatatccaccctgaatcttcagttgtacaactt
ggttcgratttcacggcagtttgtgtgctaaaggaaaaatgtatggatgattatcatgtg
actgctaatgacattttctggaaaacaggccgtgtacctgttccttatgaacaatatagt
gtcataaacagaacagcatctagtgtcacatttccaaatataactttaataaatgctctg
ctcacttgcaacattcgtatgtttggacagattaatcggagtgtttatggaatcagaatc
atttcaggcttgcctcctgaaaaacctaaaaatttgagttgcattgtgaatgaaggaaag
aaaatgatgtgtcagtgggatcctggaagggaaacatacctggaaacaaactacacttta
aaatctgagtgggcaacagagaagtttgatgattgtaaagcaaaacgtgacacccccacc
tcatgcactgttgattatcctcctgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgcccttgggaaggttacctcagatcatatcaattttgatcctgtagataaagtg
aagctcaatccaccacatattttatcagtcaacagttcaaaggaactgtctagtatttta
aaattgacatggactgattcacgttttaagagttttataacactgaaatatgacattcaa
tataggaccaaagatgcctcaacttggaaccaggttcctcctgaagatacatcatctacc
cgatcttcattcactgttcaggaccttaaaccttttacagaatatgtgtttaggattcgt
tgtatgaaggaagatggtaaaggatattggagtgactggagtgaagaagcaagtggtatc
acatatgaagatagaccatccaaggcaccaaatttctggtataagatagagccgtctcat
gctcacggcactagatctatacaactcaaatggaagacattgcctccttttgaagctaat
ggaaaaattttggattatgaagtgactctcacaaagtggaaatcacattcacaaaattac
acagttaaagacacaaaactgacagtaaacctcacaaatgatcgctacgtagcaactctg
acagcaagaaatcttgttggcaaatcagacgcgtctgttttaactatccctgcctgggat
tttcaagctactcaccccataaccgatcttaaagcatttcccaaagataacgtgctttgg
gtagaatggactgctccaaacgaatctgtaaacagatacatacttgagtggtgtgtgtta
tctgataaatcgccctgtatcccagactggcaacaagaagatggtactgtacatcgcacc
tatttaagaggaaacctagtagagagcaaatgttacttgataacagttactccagtatat
gatgatggaccaggaagccccgagcatataaaggcataccttaaacaagctgcaccttcc
agaggacctactgttcggacaaaaaaagtggggaaaaatgaagctgtcttagagtgggac
caccttcctattgatgttcagaatggatttatcagaaattatactatattttatagaacc
gtcattggaaatgaaatcgctgtgaatgtggattcttcccacacagaatacacactgtcc
tctttgactagtgacactctgtacatggtacgaatggcagcctacacagatgaaggtgga
aaggatggtccagaattcacttttactacaccaaagtttgctcaaggagaaattgaagct
attgttgtacctgtttgcttagcattcctattgacaacccttttgggagttttattctgc
tttaataagcgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcacacacctccaaggcattttaattcaaaagatcaa
atgtatccagatggcaatttcactgatgtaagtgttgtggaaatagaagcaaatgacaaa
aagcctttcccagaggatctaaagtctttggacctattyaagaaagaaaaagttaatact
gaaggacacagtagtggtattggagggtcttcatgcatgtcatcttctaggccaagcatt
tccagcagtgatgaaaatgaatctgcacagaacacttcaagcactgtccaatattccaca
gtggttcacagtggctatagacaccaggtaccatcagtccaagtcttctcaagatctgag
tccacccagcccttgttagattctgaagaacggccagaagatttacagctggtagataat
gtagatggcagtgatggcattctgcccaggcagcggtatttcaagcaaaactgcagtcaa
catgaaaccagtccagatatttcgcattttgaaaggtcacagcaagtttcctcagtcaat
gaagaagattttgttagacttaaacagcagcagatttcagatcatatttcacaaccctat
ggatctgggaaaatgaaaatgtttcaggaagttcctgcagtggatgcttttggtccaggc
attgagggacaagtagagagatttgaaacagttgggatggaggatgcagttgatgaagga
atgcctaaaagttacttaccacagactgtgagacgaggtggctacatgcctcagtga

KEGG   Bos indicus (zebu cattle): 109574945
Entry
109574945         CDS       T04792                                 

Gene name
OSMR
Definition
(RefSeq) oncostatin-M-specific receptor subunit beta
  KO
K05057  oncostatin M receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109574945 (OSMR)
   04151 PI3K-Akt signaling pathway
    109574945 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109574945 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109574945 (OSMR)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL6/12 receptor family
   109574945 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind IL6Ra-bind
Other DBs
NCBI-GeneID: 109574945
NCBI-ProteinID: XP_019838541
UniProt: A0A6P5DK92
LinkDB
Position
20
AA seq 973 aa
MALFAVLQTTFLLALLPLRTYQSEVLSEPLPLTPESLNVSINSTKQCLHLQWTVHNPDYH
QEFKMVFQIQISRFKASNVIWLENYSTTVKRNQVLHWSWESELPLECAIHFVRMRTMVDD
ARIPAPRLWSNWSSWEKADAQNSLGDHPLYVFPKDKLVEEGSNVTVCYISRNHQDNISCY
LEDVLIYGRQLDQNVWAFEFKNVSFIRKTGTNFYCKGQGDPEGVVLLVSKVLEEPKNFSC
ETQDLKTLTCTWDPGNDTGLIQLPSYTLFESFSGKKTLCKHRNRCDWQVTQDSPEMYNFT
LVAENYFRKRSVSILFNLIHGVHPMAPYSLFPKSVSATNATVTWKVYSIGSSSALLCQLQ
LLGEGKVIQQHNISVRVNGEYLLSELKPDTEYMARVRCAYADHFWKWSELISQNFTTAEA
APSEAPDVWRDVTFVSGHPTVTLFWKPLSKVHANGKILFYNVVVENLDEPSSLKVLSVPA
PANSTKVTLNQSSYQICVTAHNSVGPSPASTVAISGHPGNENVEEGRMNGTEDGFPMSWK
PQSRNATGYVVEWCDSPQHLPCVLRWKNLGPTNTDTVISSGAFRPGVRYNFRIYEISTKR
MAHLLEKKAGYLKELAPSYNPKVNMSNLTSHSFTLSWKDYPTESQTGFIQGYYVYLKSKT
GEKCHRGFEKTFLTDNSVCCKYTIDNPDQKTFVVKDLQPESAYEFLVTPYTSAGEGPLDD
FRKVTTPDEYSHILIHIILPMVFFVFVIMIICYLKSQWLKDKCYPDIPDPYKSSVLSLIK
FKENPHITIMNVNDCVPDAIEVVNKPEGSKMQFVGTRKSPTETKGTKPAYLDLLPTEKNY
SGPGPCICFENFTYNQAASDLGYCGHFPVTPQAPHCQLGPLTSPENLLKTLEQSYMNSLG
EIPAGEANLNYVSQLASPMSGDRESPPTNPPEPALCSEYKMQMAIPLGLASPARSENSSL
SSTALLDPREHCH
NT seq 2922 nt   +upstreamnt  +downstreamnt
atggctctctttgcagtcttgcagacaacattcctcttggcattgctgcccttgagaact
taccaaagtgaagttctgtctgaacctttaccattaactcctgaatcactgaacgtttcc
atcaattctacaaagcagtgtttgcatttacaatggactgtccacaaccctgattatcac
caggaattcaaaatggtttttcagatacagatcagtagatttaaagcatccaatgtcatc
tggttggagaactacagcaccactgtgaagcggaaccaagtcctgcactggagctgggaa
tctgagctccctttggaatgtgccatccactttgtaagaatgaggactatggtggatgat
gccaggattcctgcacccaggctctggagtaactggagttcatgggagaaagcagatgcc
cagaattcacttggagatcatccattgtacgttttccctaaagataagctggtggaagag
ggctccaatgtcaccgtttgttacatttctaggaaccatcaagataacatatcctgttat
ttggaagatgtactgatatatggaagacaacttgatcaaaatgtatgggcattcgagttc
aagaacgtttctttcattaggaaaactggaaccaatttctattgtaagggccaaggtgat
ccagagggcgtcgttcttttggtctcaaaagtgcttgaagagcccaagaacttttcttgc
gaaacccaggacctgaagactttgacctgtacttgggatcccgggaatgacactggcttg
attcaactgccttcctacactttatttgaatcattttccgggaaaaagacactttgtaaa
cacagaaaccggtgtgattggcaagtaactcaagactcaccagaaatgtataactttaca
ctcgtggctgaaaactactttagaaaaagaagtgtcagtattctttttaacctgattcat
ggagttcatccaatggctccctatagcttgttccctaaaagtgtcagtgctacaaatgcc
accgtgacctggaaggtatactccataggaagcagttctgcacttttgtgtcagcttcaa
ctccttggtgaaggaaaagtgatacaacaacacaatatctccgtcagggtgaatggtgag
tacctcttaagtgaactgaagccggacacagaatatatggcccgtgtacgctgtgcttat
gccgaccacttctggaaatggagtgaattgattagccagaacttcaccacagctgaagct
gctccatcggaggcgcccgatgtctggagagatgtgacatttgtgtcaggacatccaacg
gtgaccttgttctggaagcctctatcaaaagtgcacgccaatgggaagatcctgttctat
aatgtagttgtagaaaatcttgatgaaccgtccagtttaaaggtcctctctgtccctgct
ccggccaacagcacaaaagtaaccctcaatcagagttcttaccagatctgtgtcacggct
cacaacagtgtgggtccttctccggcttccacagttgccatttctggacatcctggaaat
gaaaatgttgaagaaggaagaatgaatggtacagaggatggatttcccatgtcttggaaa
ccccaatccagaaatgccacaggttacgttgtggagtggtgtgacagtccccagcacctt
ccctgtgttctccggtggaaaaacctaggccccactaacacagacacagtcattagctcg
ggtgcttttagaccaggggttcgctacaacttcagaatttatgaaatttctacaaaaagg
atggcccatttattagagaaaaaagctggctatttgaaggaactggctccttcatacaac
cctaaagtgaatatgagtaacttgacctcccactccttcactctgagttggaaggattat
cccaccgaatctcaaactggttttatacaagggtactatgtctacctgaaatccaagaca
ggggagaagtgccaccggggatttgaaaagacatttcttacagataattcagtatgttgc
aaatacacaattgacaacccggatcaaaagacatttgttgtgaaagacctacagccagaa
tctgcctatgagtttttggtcactccttatacaagtgctggtgagggtcccctggatgac
ttcagaaaggtcacgactccggatgaatactcccatatactgatacacatcattctcccc
atggttttcttcgtttttgtcatcatgatcatctgctacctaaaaagccagtggttgaag
gacaagtgttatcctgacattccagacccttacaagagcagcgtcctgtcattaataaaa
ttcaaggagaatcctcatataacaataatgaacgtcaatgactgtgttccagatgctatt
gaagttgtaaacaagcccgaagggagtaagatgcagttcgtaggcactaggaagtcaccc
acagaaactaaaggtactaagcctgcctatctggacctgctcccaacagagaagaactac
tctggccctggaccttgcatctgttttgagaactttacctataatcaggcagcttctgac
ttgggttattgtggacatttcccagtaacccctcaagccccacactgtcagctgggacca
ctgacttcacctgaaaatttactcaagacactggaacaaagctacatgaactccctggga
gaaatcccagctggagaagctaatttgaattatgtatcccagttggcttcacccatgtct
ggagacagggagagcccaccaacaaatccaccagagccagcactctgttcggagtataaa
atgcaaatggctattcccctgggtcttgcctcccccgcccgaagtgagaatagcagccta
tcttccactgcccttttagatccgcgtgaacactgccactaa

KEGG   Bos indicus (zebu cattle): 109574973
Entry
109574973         CDS       T04792                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor isoform X1
  KO
K05081  prolactin receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109574973 (PRLR)
   04151 PI3K-Akt signaling pathway
    109574973 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109574973 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    109574973 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109574973 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109574973 (PRLR)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  Prolactin receptor family
   109574973 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind Tissue_fac
Other DBs
NCBI-GeneID: 109574973
NCBI-ProteinID: XP_019838590
UniProt: A0A6P5DMZ2
LinkDB
Position
20
AA seq 581 aa
MKENAASRVVFILLLFLNVSLLNGQSPPEKPKLVKCRSPGKETFTCWWEPGADGGLPTNY
TLTYHKEGETLIHECPDYKTGGPNSCYFSKKHTSIWKMYVITVNAINQMGISSSDPLYVD
VTYIVEPEPPANLTLELKHPEDRKPYLWIKWSPPTMTDVKSGWFIIQYEIRLKPEKATDW
ETHFTPKQTQLKIFNLYPGQKYLVQIRCKPDHGYWSEWSPESSIQIPNDFPVKDTSMWIF
VAILSAVICLIMVWAVALKGYSMVTCILPPVPGPKIKGFDVHLLEKGKSEELLRALESQD
FPPTSDCEDLLMEFIEVDDCEDQQLMPRPSKEHTEQGVKPMHLDLDSDSGRGSCDSPSLL
SEKCDEPQAHPSKFHTPEGPEKLENPETNLTCLQAPQSTSGEGKIPYFLANGPKSSTWPF
PQPPSLYSPRYSYHNIADXCELALGMAGTTATSLDQTDQHALKASKTIETGREGKATKQR
ESEGCSSKPDQDTVWPXPQDKTPLISAKPLEYVEIHKVSQDGVLALFPKQNEKFGAPEAS
KEYSKVSRVTDSNILVLVPDPQAQNLTLLEEPAKKAPPALP
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgaaggaaaatgcagcatctagagtggttttcattttgctactttttctcaacgtcagc
cttctgaatggacagtcacctcctgaaaaacccaagctcgttaaatgtcggtctcctgga
aaggaaacattcacctgctggtgggagcctggggcagatggaggacttcctaccaattac
acgctgacttaccacaaggaaggagaaacactcatccatgaatgtccagactacaaaacc
gggggccccaactcctgctactttagcaagaagcacacctccatatggaagatgtacgtc
atcacagtaaacgccatcaaccagatgggaatcagttcctcggatccactttatgtggac
gtgacttacatagttgaaccagagcctcctgcaaacctgactttggaattaaaacatcca
gaagatagaaaaccatatctatggataaaatggtctccacccaccatgactgatgtaaaa
tctggttggttcattatccagtacgaaattcgattaaaacctgagaaagcaactgattgg
gagactcattttactccgaagcaaactcagcttaagattttcaacttatatccaggacaa
aaataccttgtgcagattcgctgcaagccagaccatggatactggagtgagtggagccca
gagagctccatccagatacctaatgacttcccagtgaaggacacaagcatgtggatcttt
gtggccatcctttctgctgtcatctgtttgattatggtctgggcagtggctttgaagggc
tatagcatggtgacctgcatcctcccaccagttccagggccaaaaataaaaggatttgat
gttcatctgctggagaagggcaagtccgaagaacttctgcgagctctggaaagccaagac
ttcccccccacttctgactgcgaggacttgctgatggagttcatagaggtagatgactgt
gaggaccagcagctgatgccacgcccctccaaagaacacacggagcaaggcgtgaagccc
atgcacctggatcttgacagtgactctggccggggcagctgcgacagcccttcgctcttg
tctgaaaagtgtgatgaacctcaggcccatccctccaagttccatactcccgagggccct
gagaagctggagaatcccgaaacaaaccttacatgtctccaggcccctcagagcacaagc
ggggaaggcaaaatcccctattttctggccaatggacccaaatcttccacatggcctttc
ccgcagccccccagcctatacagccccagatattcttaccacaacattgctgacrtgtgt
gagctggccctgggcatggcaggcaccacagccacttcgctggaccaaacagaccaacat
gctttaaaagcctcaaaaaccattgaaactggcagggaaggaaaggcaaccaagcagagg
gagtcagaaggctgcagttccaagcctgaccaagacacggtgtggccackaccccaagac
aaaacccccttgatctctgctaaacccttggaataygtggagatccacaaggtcagccaa
gatggagtgctggctctgttcccaaaacaaaacgagaagtttggcgcccctgaagccagc
aaggagtactcaaaggtgtcccgggtgacagatagcaacatcctggtrttggtgccggat
ccgcaagcrcaaaacctgactctgttagaagaaccagccaagaaggccccgccagccctg
ccatag

KEGG   Bos indicus (zebu cattle): 109575020
Entry
109575020         CDS       T04792                                 

Gene name
IL7R
Definition
(RefSeq) interleukin-7 receptor subunit alpha isoform X1
  KO
K05072  interleukin 7 receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04068  FoxO signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
biu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109575020 (IL7R)
   04068 FoxO signaling pathway
    109575020 (IL7R)
   04151 PI3K-Akt signaling pathway
    109575020 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109575020 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109575020 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109575020 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    109575020 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109575020 (IL7R)
   04090 CD molecules [BR:biu04090]
    109575020 (IL7R)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL2 receptor family
   109575020 (IL7R)
CD molecules [BR:biu04090]
 Proteins
  109575020 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 109575020
NCBI-ProteinID: XP_019838649
UniProt: A0A6P5DLF5
LinkDB
Position
20
AA seq 459 aa
MTLLSIALGTLFYLLQAVSGESGYAENGDFDDAELEDYSFSCYSQLEVDGLQHLLTCMFD
DSDINSTNLEFEICGALLDXDCLNFNKLQERYFLKTKKFLLIGDSKICVKLEKKNMTCRK
VNIVKIVKPEAPFDVRVVYREGANDFVVTFNTSHLQKKYVKVLIHEVAYRQEKNENNWMR
VNLTSTKLTLLQRKLQPNAMYEIKVRSIPYANYFEGFWSEWSPSFHFRTPETNGTGETDP
VLLTISILSFFSVALMVTLACVLWKKRIKPIIWPSLPDHKKTLEQLCKKPKKNLNVSFNP
ESFLDCQIHKVDGIQAKDEAEGFLQDPLPPQPEESDKQRFRAGMQGPSWPSEQAGITPKI
FRGESPFRCLAGNASVCDAPGLLSSRSPNGREGGKSRPLVYQDLLLGPGTTNSSLPPPFP
FQPGILTLNPVAQGQPILXSLGSSQEEAYVTMSSFYQNQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacacttctaagtattgctttgggtacgcttttctatttacttcaagccgtttctgga
gaaagcggctatgcagagaatggagattttgacgatgcagaactggaagactactcattc
tcatgctacagtcagctggaagtggatggactccagcacttgctgacctgcatgtttgat
gactcggacatcaacagcaccaatctggaatttgaaatatgtggggcgcttttggatrta
gattgcctgaattttaataaactgcaagagaggtatttcctcaagacaaagaaattctta
ctgattggagacagtaaaatatgtgtgaagcttgaaaaaaagaacatgacttgcagaaaa
gtgaacatagtcaagatagttaaacctgargctccttttgacgtcagagtcgtctatcgt
gagggagcaaatgactttgtggtgacatttaatacatcacacttgcagaagaagtatgtg
aaagtattaatacatgaggtagcctaccgtcaggaaaaaaatgaaaataattggatgcgt
gtgaatttaaccagtaccaagctgacactcctacagagaaaactacaacccaatgccatg
tatgagattaaagttcggtccatcccttacgccaactattttgaaggcttctggagtgaa
tggagtccaagtttccactttagaactccggagaccaayggcacaggggagacggatcct
gtgttactaactatcagcattctgagcttcttctctgtggctctgatggtcactctggcc
tgtgtcttatggaaaaaaagaattaaacctattatatggcccagtctccctgatcataag
aagactctggaacaactgtgcaagaaaccaaaaaaaaatttgaatgtgagtttcaatcct
gaaagtttcctggactgccagattcataaggtggatggcattcaagctaaagatgaagca
gaaggcttcctgcaagaccctcttcctccacagccagaagagagtgacaagcagaggttc
agagccgggatgcagggtcccagctggccctccgagcaagcaggcattacccctaaaatt
ttcagaggagagtcaccattcagatgcctggctgggaatgccagtgtgtgtgatgcccct
gggctcctctcctccaggtctcctaatggcagggaaggtggcaagagcagacctctagtg
taccaggacctgctcctcggacctggaactacaaacagctccctgccccctccgtttcca
ttccaacccggaatcctgacattgaaccctgttgcccaggggcagcccatcctcasttcc
ttgggatcaagtcaagaagaagcctatgtcaccatgtccagcttctaccaaaaccaatga

KEGG   Bos indicus (zebu cattle): 109575848
Entry
109575848         CDS       T04792                                 

Gene name
IL5RA
Definition
(RefSeq) interleukin-5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109575848 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109575848 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109575848 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109575848 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109575848 (IL5RA)
   04090 CD molecules [BR:biu04090]
    109575848 (IL5RA)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL3 receptor family
   109575848 (IL5RA)
CD molecules [BR:biu04090]
 Proteins
  109575848 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind Tissue_fac fn3 Il13Ra_Ig LIFR_D2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 109575848
NCBI-ProteinID: XP_019839662
UniProt: A0A6P5DRL0
LinkDB
Position
22
AA seq 517 aa
MVIRNERINRRRQVVIIMAPELLILLGAAVILQADLLPDKKFLLLPPVNFTIKAVNLAQV
LLRWEPNPDQEQSNIQLGYHVKINAPQEEDYETRNTERNLITILHKGFSASVRTVPWNDH
SLQASSWVSAELKAPXGSPGTEIVNLTCTTNTKADNYTHLRPYQVSLHCTWLVGKDAPDD
TQYFLYYRYRSWIEECQEYSKDVLQRNVACWFPRTFINSKGRDYLAVYVNGSSKGAAIKP
FDQLFALHAIDRVNSPANVTAEIKGTCLSIHWEKPVSAFPSHCFDYEVKIYNAKKGYFQT
EKMTTNTLITIIDDVSKYYIQVRAAVSPVCRATGLWSEWSRPIYVGKDDQKPWTEWFLIA
VMMTICFXLLIFSLICRICHVWTKLFPPVPGPKSNINDFFVIINNESKHAEVENTALFIT
VCLTAGNACPNLVGLPSPGQLEPLLRTELPGAGTTPSAHVIHVPYFNVPMASFPHKDKSL
RQLPPHRLEEMQAHLRMKFIIHIFRPGGKMLFHTQVL
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggtcatcagaaatgagaggatcaaccgaaggagacaggttgtgatcatcatggcacct
gaattactgattcttttgggggcrgcagtaatactgcaagcagacttacttcctgataaa
aaatttttacttctaccaccagtcaatttcaccattaaagctgtcaatttagctcaagtt
cttttacgttgggaaccaaatcctgatcaagaacaaagcaatatccagctaggatatcat
gtgaaaataaatgctccacaagaagaagattacgaaaccaggaacactgaaagaaacctc
ataaccatccttcacaaaggcttttcagcgagtgtgcggacagtgccctggaacgaccac
tccctacaagccagcagctgggtttctgcagaacttaaagccccaayagggtctcctgga
actgagattgtgaatttaacttgcaccacaaacacgaaagcagataattacacacactta
cgaccataccaagtttctcttcactgcacctggcttgttggcaaggatgcccctgatgat
acacagtacttcctctactacaggtatcgctcttggattgaagaatgtcaggaatacagc
aaagacgtcctgcagagaaatgttgcctgctggtttcccaggactttcatcaatagcaaa
gggcgagactacctkgcagtgtatgttaacggctctagcaagggagctgcgatcaagcct
tttgatcagctctttgccctycatgccattgatcgagtaaattctccagcgaacgtcacg
gcagagatcaaaggaacctgtctctctatccactgggaaaaaccagtttctgcttttcca
agccactgcttcgattatgaggtgaaaatttacaatgcaaagaaaggatattttcagaca
gaaaaaatgacaaccaatacactcatcaccataattgatgatgtttctaagtattacatt
caagtgagagcagcagtgagccctgtgtgcagagcgacggggctctggagcgagtggagt
cggcccatttacgtggggaargatgatcagaagccctggacagagtggtttcttattgca
gttatgatgaccatctgcttcrtcttgttaattttctcactcatctgcagaatatgccac
gtatggaccaagttgtttccgcctgttccagggccgaagagtaatattaaygatttcttt
gtaatcatcaacaatgagtcgaaacatgccgaggttgagaacacggccctgtttatcacc
gtgtgcctaacagcagggaacgcctgccccaacctcgtgggcctaccttcacctgggcag
cttgagcccctgctgagaaccgagcttccgggagccggaaccaccccttcggctcacgtg
atccacgtgccttattttaatgttccaatggcctcttttccccataaagataaaagctta
aggcagctcccacctcacaggttggaagagatgcaagctcacctgaggatgaaatttatt
atccacatcttccgccccggtggaaagatgctgtttcatactcaggttttgtga

KEGG   Bos indicus (zebu cattle): 109576048
Entry
109576048         CDS       T04792                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04072  Phospholipase D signaling pathway
biu04144  Endocytosis
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04520  Adherens junction
biu04540  Gap junction
biu04630  JAK-STAT signaling pathway
biu04810  Regulation of actin cytoskeleton
biu04912  GnRH signaling pathway
biu04915  Estrogen signaling pathway
biu04921  Oxytocin signaling pathway
biu04926  Relaxin signaling pathway
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu05160  Hepatitis C
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109576048 (EGFR)
   04012 ErbB signaling pathway
    109576048 (EGFR)
   04014 Ras signaling pathway
    109576048 (EGFR)
   04015 Rap1 signaling pathway
    109576048 (EGFR)
   04630 JAK-STAT signaling pathway
    109576048 (EGFR)
   04066 HIF-1 signaling pathway
    109576048 (EGFR)
   04068 FoxO signaling pathway
    109576048 (EGFR)
   04020 Calcium signaling pathway
    109576048 (EGFR)
   04072 Phospholipase D signaling pathway
    109576048 (EGFR)
   04151 PI3K-Akt signaling pathway
    109576048 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109576048 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109576048 (EGFR)
   04520 Adherens junction
    109576048 (EGFR)
   04540 Gap junction
    109576048 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109576048 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109576048 (EGFR)
   04915 Estrogen signaling pathway
    109576048 (EGFR)
   04921 Oxytocin signaling pathway
    109576048 (EGFR)
   04926 Relaxin signaling pathway
    109576048 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    109576048 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109576048 (EGFR)
   05206 MicroRNAs in cancer
    109576048 (EGFR)
   05205 Proteoglycans in cancer
    109576048 (EGFR)
   05230 Central carbon metabolism in cancer
    109576048 (EGFR)
   05231 Choline metabolism in cancer
    109576048 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109576048 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109576048 (EGFR)
   05212 Pancreatic cancer
    109576048 (EGFR)
   05225 Hepatocellular carcinoma
    109576048 (EGFR)
   05226 Gastric cancer
    109576048 (EGFR)
   05214 Glioma
    109576048 (EGFR)
   05218 Melanoma
    109576048 (EGFR)
   05219 Bladder cancer
    109576048 (EGFR)
   05215 Prostate cancer
    109576048 (EGFR)
   05213 Endometrial cancer
    109576048 (EGFR)
   05224 Breast cancer
    109576048 (EGFR)
   05223 Non-small cell lung cancer
    109576048 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109576048 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109576048 (EGFR)
   05171 Coronavirus disease - COVID-19
    109576048 (EGFR)
   05163 Human cytomegalovirus infection
    109576048 (EGFR)
   05165 Human papillomavirus infection
    109576048 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109576048 (EGFR)
   01522 Endocrine resistance
    109576048 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109576048 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109576048 (EGFR)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109576048 (EGFR)
Protein kinases [BR:biu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   109576048 (EGFR)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109576048 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   109576048 (EGFR)
  Exosomal proteins of bladder cancer cells
   109576048 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Borrelia_P83 Kinase-like Kdo
Other DBs
NCBI-GeneID: 109576048
NCBI-ProteinID: XP_019839912
UniProt: A0A6P5DSH4
LinkDB
Position
22
AA seq 1208 aa
MRLSGAGRAALLVLLAAHFQTSLALEEKXVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQSSYNLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLYENTHALA
VLSNYGANKTGLRELPLRNLQEILQGAVRFSNNPVLCNVETIQWRDIVNPDFLSNMTGDF
QNQQGNCPKCDPACLNRSCWGAGEENCQKLTKIICAQQCSGRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCRRFRDEATCKDTCPPLMLYDPTTYEMKVNPLGKYSFGATCVKKCPRNYV
VTDHGSCVRACSSDSQEVEEDGVRKCKKCDGPCGKVCNGIGIGEFKDTLSINATNIKHFR
NCTSISGDLHILPVAFRGDSFTRTAPLDPKELDILRTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNRNLCYADTIRWKKL
FGTSTQKTKILNNRSEKQCKAAGHICHPLCSSEGCWGPGPKYCMSCQNFSRGKECVGKCN
ILEGEPREFVENSECVQCHPECLPQAMNVTCTGRGPGNCVKCAHYIDGPHCVKTCPAGVA
GENGTLIWKFADANHVCLLCHPNCTYGCEGPGLEGCPQKGPKIPSIATGIVGGLLLVVVL
ALSVGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKVKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNVGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLVPQ
QGFFHSPTTSRTPLLSSLSTSSNTPTVTCVDRNGSYPLKEDSFLQRYSSDPTGALIEDSM
DDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLYPAPGRDPQYQNSLSNAVDNPEYLNTT
HPACINGVLDGPALWAQKGSHQFSLDNPDYQQAFFPKEAKSNGIFKGPAAENAEYLRAAP
AGSDFTGA
NT seq 3627 nt   +upstreamnt  +downstreamnt
atgcgactctccggggcgggccgcgcggcgctcctggtgctgctggcagcgcacttccag
acgagtctagcgctggaggagaagaragtttgccaagggacaagcaacaagctcacccag
ttgggcacttttgaagaccactttctgagcctacagaggatgttcaacaactgtgaggtg
gtccttgggaatttggaaattacctacatgcagagtagttacaacctttcttttctcaag
accatccaggaggttgccggctatgtactcattgccctcaacacagtggagaagattccg
ctggaaaacctgcagatcatccgaggaaatgtgctttatgaaaacacccatgccttagcc
gtcttatccaactatggagcaaacaaaaccggactgagggagctgcccttgagaaactta
caggaaattctgcaaggtgccgtgagattcagcaacaaccctgtcctctgcaacgtggag
accatccagtggcgggacatcgtcaaccctgattttctaagcaacatgacaggggacttt
cagaaccagcagggcaactgcccaaagtgtgatccagcctgtctcaacagaagctgctgg
ggtgccggggaggaraactgtcagaaattgaccaaaatcatctgtgcccagcagtgttcc
gggcgctgccgtggcaggtcccccagtgactgctgccacaaccagtgtgccgctggctgc
acagggccacgggagagcgactgcctggtctgccgcaggttccgtgatgaagccacctgc
aaggacacgtgtccgccactcatgctctatgaccctaccacctacgaaatgaaggtcaac
ccgctggggaagtacagctttggcgccacctgtgtcaagaagtgtccccgtaactacgtg
gtgacagaccacggctcctgcgtccgcgcctgcagttctgacagccaggaggtagaggaa
gacggtgtccgcaagtgtaaaaagtgtgacgggccttgtggcaaagtttgtaacggaata
ggaatcggtgagtttaaagacacactttccataaatgctacaaacattaaacacttcaga
aactgcacatccatcagtggagatcttcatatcctgccagtagcatttaggggtgactcc
ttcacacgtactgcacctctggacccgaaagaactggacattctaagaactgtaaaagaa
ataacagggtttttgctgattcaggcctggcccgaaaacaggactgacctccatgctttt
gagaacctggaaatcatacgtggcagaacgaagcagcatggccagttttctcttgcggtt
gtcggcctggatataacatctttgggattacgctccctcaaggagataagtgatggtgat
gtgataatttcaggaaatcgaaacttgtgctatgcagatacaatacgctggaaaaaactt
tttgggacctcaactcagaaaaccaaaattttaaacaacaggagtgaaaaacagtgcaag
gccgcaggccacatctgtcacccgctgtgctcatcagagggctgctggggaccgggaccc
aaatactgcatgtcctgccagaacttcagtcgtggcaaggagtgtgtgggaaagtgcaac
attctagagggagagcccagagaattcgtggagaactccgagtgtgtgcagtgccatcca
gaatgcctgccccaggccatgaacgtgacctgcactggacgcggaccaggcaactgtgta
aagtgcgcccactacattgatggccctcactgcgtcaagacctgccctgctggagtcgcg
ggagagaatggcaccctgatctggaagtttgcagatgccaaccacgtgtgtctcctgtgc
caccccaactgcacctatggctgtgaagggccaggtctcgaaggctgtccacaraaaggg
cccaagatcccgtccattgccacgggcatcgtgggcggcctgctgctggtggtggtgctg
gccctgagcgtcggcctcttcatgcgcaggcgccacatcgtgcgcaagcgcacactgcgc
cggctgctgcaggagcgtgagctcgtggagcctctgacgcccagcggagaagctcccaac
caagctctcttgaggatcctaaaggaaacagaattcaagaaggtcaaggtgctgggctcg
ggagcatttggcaccgtgtacaagggactctggatcccagaaggcgagaaggttaaaatt
cctgtagctatcaaggaattaagagaagccacatctccaaaagccaacaaggaaattctt
gatgaggcctacgtgatggccagtgtggacaacccccatgtgtgccgcctcctgggcatc
tgcctgacctccaccgtgcagctcatcacacagctcatgcccttcggctgcctgctggac
tacgtccgcgagcacaaggacaatgtcggctcccagtacctgctcaactggtgtgtgcag
atcgcaaagggcatgaattacctggaagaccggcgcttggtgcatagggacctggcagcc
aggaacgtgctggtgaagacgccgcagcacgtgaagatcacagacttcgggctggccaag
ctgctgggtgccgaggagaaggagtatcatgcagaaggaggcaaggtccctatcaaatgg
atggctttggaatcaattttacaccgaatttatacccatcagagtgatgtctggagctat
ggagtcactgtttgggagttgatgacctttggatccaagccttacgatggaatccctgcg
agtgagatctcgactgtcctggagaaaggagagcgcctcccacagccacccatctgcacc
atcgacgtctacatgatcatggtcaagtgctggatgatagatgcagacagtcgcccaaag
ttccgtgagttgatccttgaattctccaagatggcccgagacccccagcgctaccttgtc
atccagggggacgagagaatgcatttgccaagccctacggactccaacttctaccgcgcc
ctgatggatgaggaggacatggaggatgttgtggatgcygatgagtacctcgtcccccag
cagggcttcttccacagccccaccacctcccggacacccctcctcagctcgctgagcacc
tccagcaacactcccactgtgacttgcgttgatagaaatgggagctaccctctcaaggaa
gacagcttcctgcagcgctacagctcagaccccactggtgccctcatcgaggacagcatg
gacgacgctttcctcccagtacccgaatatgtaaaccaatctgttcccaaaagacccgca
ggctctgtccagaaccctgtctatcacaatcagcctctatatccagctcctggcagagac
cctcagtaccaaaattcwctcagcaacgccgtggacaaccctgagtatctcaacaccacc
catcctgcctgtatcaatggtgtgctcgacggccctgccctctgggctcagaagggcagt
caccaatttagcctagacaaccctgactaccagcaggccttctttcccaaggaagccaag
tcgaatggcatctttaaggggcctgcagctgaaaatgcagaatacctgcgggcagcacca
gcaggcagtgactttactggggcctga

KEGG   Bos indicus (zebu cattle): 109577127
Entry
109577127         CDS       T04792                                 

Gene name
IL22RA1
Definition
(RefSeq) interleukin-22 receptor subunit alpha-1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109577127 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109577127 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109577127 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109577127 (IL22RA1)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL10/28 receptor family
   109577127 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 109577127
NCBI-ProteinID: XP_019841458
UniProt: A0A6P5DSS1
LinkDB
Position
2
AA seq 581 aa
MRTLLTILAAGSLLAHITEDTSDLLQHVKFQSSNFENILTWDGRPESAPDTVYSVQYKTY
GEEEWLEKEGCQRITQKSCNLTMETSNLTELYYARVTATDGAGRSATKMTNRFSSLQHTS
IKPPDVTCIPKVRSIQMIVHPTYTPIRAQNGHQLTLENIFQDLLYHLKLRINHTYQMHLE
GKQREFEFVGLTPDTEFLGTIMICIPNLFKESXPYMCRVKTLPDRTWTYSFSGAFLFSLG
FLVAGLCYLSYRYITKPPPPPSSLNVQHILPFXPLXFIQEHTLIPVFDLSGSGGLAQPVQ
YSEVKVSBPTEPXGPPPRHSLPEIAYLGQPDLPVLRPSGGPPHQALPVLSYAPQAAPEGR
PSSYAPQGXLEAKPPSYTPQAVSEXQLPSYTPRATPDNWPPSYGMCGEGSGRDSPPVTRS
GPKHLGTKGQLQKEVPAGSCSPTGLSLQEVTPLAMEDPQEAKSSHQXLRVHTDSDSDSDT
IGQREPGTRSSLKGQLPLLSSVQIEGHPGCLPLQTPSLPCSPTDKGPSPWGLLESLVCPX
DEDPVSKTEAESPGLQAPDLESPTELDSLFRGLALTVQWES
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgaggacrctactgaccatcctggcrgcgggatccctgctcgctcacatcactgaggac
acctcagatctccttcagcacgtgaagttccagtccagcaacttcgaaaacatcctgacg
tgggacggcaggccggagagtgcccccgacaccgtctacagcgtccagtataagacgtat
ggagaggaagagtggttggaaaaggagggctgccagcggatcacccagaaatcctgcaac
cttaccatggagacgagcaacctcactgagctctactacgcccgggtcaccgccactgac
ggggcaggccggtctgccaccaagatgaccaaccgcttcagctcactgcagcacactagc
atcaaaccacctgatgtgacctgtatccccaaggtaagatccatccagatgatcgtccat
cccacctacacaccaatccgcgcacagaatggccaccagctgaccttggagaacatcttc
caggacctactctaccacttaaagctgcgcatcaaccacacctatcaaatgcaccttgaa
gggaagcagagagaatttgagtttgtcggcctgacccctgacacggagttccttgggacc
atcatgatttgtattccaaacttgttcaaggagagcrccccctacatgtgccgagtgaag
acgytgccagatcggacgtggacctactccttctccggtgccttcctgttctccctgggc
ttcctggtcgcagggctytgctacctgagctacagatacatcaccaagccgcctccacct
cccagctccctgaatgtccagcacatcctgcccttccrgcctctgcrgttcatccaggag
cacaccctgatccccgtcttcgacctcagcggctccggcggtctggcccagcctgtccag
tactccgaagtcaaggtctccraccccacggagccccygggacccccaccgcggcayagc
ctgcctgagattgcctaccttgggcagccagacctcccygtcctccggccctccggagga
ccacctcaccaggcactccccgtgctctcctatgccccccaggctgctcccgagggcagg
ccctcgtcctatgcacctcagggarctctggaagctaaacccccctcctacactccacag
gctgtctcagagrcccagcttccctcctacaccccacgggccaccccggataactggcct
ccttcctaygggatgtgcggggaagggtctgggagagactccccmcctgtgacacgctct
ggtcccaaacacctcggaactaaggggcagctccagaaagaggtgccagctggaagctgc
agcccaactggcctttcgctacaggaggtgacccccctggccatggaggacccccaagaa
gcaaaatcctcccaccagygtctaagggttcacacmgactcagactctgactctgatacc
ataggccaaagggagccaggaacacgaagctccctaaagggccagctgcccctcctctcc
tctgtccagatcgagggccacccsgggtgcctccctttgcagactccttccctcccatgt
tcccccacagacaagggtccaagtccctggggcctgctggagtccctcgtgtgtcccart
gatgaggatccagtgtccaagactgaggccgagagcccaggccttcaggccccagacctg
gagtcgcccacggagctggactctctgttccgaggcctggccctaacagtgcagtgggag
tcctga

KEGG   Bos indicus (zebu cattle): 109578521
Entry
109578521         CDS       T04792                                 

Gene name
IL4R
Definition
(RefSeq) interleukin-4 receptor subunit alpha isoform X1
  KO
K05071  interleukin 4 receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu05200  Pathways in cancer
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109578521 (IL4R)
   04151 PI3K-Akt signaling pathway
    109578521 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109578521 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109578521 (IL4R)
   04658 Th1 and Th2 cell differentiation
    109578521 (IL4R)
   04659 Th17 cell differentiation
    109578521 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109578521 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109578521 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109578521 (IL4R)
   04090 CD molecules [BR:biu04090]
    109578521 (IL4R)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL2 receptor family
   109578521 (IL4R)
CD molecules [BR:biu04090]
 Proteins
  109578521 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 109578521
NCBI-ProteinID: XP_019843369
UniProt: A0A6P5DZB2
LinkDB
Position
25
AA seq 844 aa
MGRLLSVLMFPVSCLILLWVAGSGSMRVLQDPTCFSDYISNSTCEWEMAGPTNCRAELHL
SYQLNFYYSENHTCVPENRAGVGGTVCICHMLTENPVRQDXYQLDLWAGKQLLWNSSFKP
SEHVKPPAPRNLTVHADISHTWLLTWNNPYPSDNLLYSELTYLVNISNENDPTDVQVGGG
HCQPLTFSPQILTLEGQHLNARGPGAPWSQFRTYNVTYMGPTLRVAASTLRSGASYSARV
KAWAQSYNSSWSXWSPSTXWLNYYEDTWEQRLQLGVGISCVIVLAVCVSCYISIIKIKKE
WWDQIPNPAHSPLVAVVIQDSQVSLWRKRSRGQEPAKCPHWKTCLAKLLPCLLEHGMERD
DDFSKAARNGPSQGSGKVAWCPVEVSKTILRPESISVVRCVELFEAQVEKEEEEVEEDKG
SFCPSPENSGGLFQEGREDIAARLTESLFLHLLRDXTGGFSPQGVESCLLPPLENANAQR
PWAEFPRVEXQEASSEDKEQPLSPESSPPXTPTQNPAGLPLPEMPTIISDNPAYRSFSTF
LSQSSGPGELDSDPQLAECLGEVDPNIPTTPKPEPETWEQILRQRVLQHRAAPGPASAPS
SGYREFVQAVKEGGTQDSGPAGFGPSEEAGYKAFSSLLASSDSCPATSGVDPSSGEGGYK
PFQSLASGCPRTPSPTPVPLFTFGLDMDPPHSPQDSEWPELEPAVKGDDGQKPLFAPVPV
TDPLRDDLGNGIIYSALTCHLCGHLKQCHGQEEAGKAQIVVSPCCGCCCGDRSSPLLSPL
KAPDSLPQGTPLAASLSAASLAPLGVSEEGKCPLFNAPSHAQSSGQAPAVTAVPSPGPTC
MDAS
NT seq 2535 nt   +upstreamnt  +downstreamnt
atggggcggcttctctctgtactcatgttcccagtgagctgcctgatcctgttatgggtg
gccggctctgggagcatgagggtccttcaggatcccacctgcttctcggactacatcagc
aactccacctgtgagtgggagatggccggacccaccaactgcagagccgagctccacctg
tcctaccagctgaatttttactactctgaaaaccacacatgtgtccccgagaacagagca
ggtgtggggggcacagtgtgcatatgccatatgctgacagagaacccagtcagacaagac
atstaccagctggacctgtgggcagggaagcagctactgtggaacagctccttcaagccc
agcgagcacgtgaaaccaccggcccccagaaacctcacggttcacgccgacatctcccac
acgtggctgctgacgtggaacaacccgtacccttctgataacctcctgtactccgagctc
acctacctggtcaacatctcaaatgaaaatgaccccacggatgtgcaggtgggtggaggc
cattgtcagccactcacgttctcgcctcagatactcacattggagggacaacatctgaac
gccagaggccctggcgccccgtggagccagttcagaacctataacgtgacctacatgggg
cccaccctgcgtgtcgcggccagcaccctgaggtctggagcttcctacagcgcacgggtg
aaggcctgggctcagagctacaacagcagctggagckcgtggagccccagcaccamgtgg
cttaactactacgaggacacctgggagcagcgcctccagctgggcgtcggcatctcgtgc
gtcatcgtcctggcggtgtgcgtgtcctgctacatcagcatcatcaagattaagaaagaa
tggtgggaccaaattcccaacccagcccacagccccctygtggctgttgtcatccaggat
tctcaggtgtcactgtggaggaagcggtctcgaggccaggaaccagccaaatgcccacac
tggaagacttgtcttgccaagctcctgccctgtttactggagcatggcatggagagggat
gacgacttctctaaggctgctagaaatgggccttcccagggttctgggaaagtagcatgg
tgccccgtggaggtcagcaagacgatcctccggcctgagagcatcagcgtggtgcggtgc
gtggagctgtttgaggcccaagtggagaaggaagaagargaagtggaggaagataaaggg
agcttctgcccatcacctgagaacagcgggggcctcttccaggagggcagagaggacatt
gcggcccggctgacagagagcctgttcctgcaccttctcagagatgasactgggggcttt
agtccacaaggtgtggagtcctgccttcttccccctttagaaaatgcaaatgctcagagg
ccctgggccgaattcccaagggtggarycccaggaggcatcatctgaggacaaggaacag
cctctgagcccagagtcaagtcctccggscactccaacccagaacccagccggcctgcct
ctcccagagatgcccaccatcatctcagacaaccctgcttaccgcagcttcagcaccttc
ctgagccagtcctcgggccctggagagcttgactcagacccacagctggccgaatgcctg
ggggaagtggaccccaacatccccaccacccccaagccggaaccagagacctgggaacag
attctgcgtcagagggtgctccagcacagggcggcccccggccccgcctcggcccctagc
agcggctaccgggaatttgtgcaggcggtgaaggagggtggcacccaggacagcgggccg
gctggcttygggccctctgaagaggccggctacaaggccttctccagcttgcttgccagc
agtgacagctgccctgcgacttctggggttgaccccagcagcggggaagggggctacaaa
cccttccagagccttgcttctggctgccccaggaccccttcccccactcccgttcccctg
ttcactttcggcctggacatggacccccctcacagtcctcaggactcagagtggcctgag
ttggagccagcagtcaagggagacgatggacagaaacccctcttcgcccccgtgccggtc
acagaccctctcagggacgacctgggcaacggcatcatctactcagccctcacctgccac
ctatgtggccacctgaagcagtgccacggccaggaggaagctggcaaggcgcaaattgtg
gtcagcccctgctgcggctgctgctgtggggacaggtcctcgcctctgctgagtccgctg
aaagccccagactccctgccccaggggactccactggcagccagcctctctgcggcctcc
ctagcacccttaggtgtctcagaggagggtaagtgccctctgttcaatgcccccagccat
gcccagagctcaggccaggctcctgcagtgactgccgtgccctccccaggccccacgtgc
atggacgcttcctag

KEGG   Bos indicus (zebu cattle): 109578826
Entry
109578826         CDS       T04792                                 

Definition
(RefSeq) interleukin-9 receptor-like
  KO
K05073  interleukin 9 receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109578826
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109578826
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109578826
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109578826
   04090 CD molecules [BR:biu04090]
    109578826
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL2 receptor family
   109578826
CD molecules [BR:biu04090]
 Proteins
  109578826
SSDB
Other DBs
NCBI-GeneID: 109578826
NCBI-ProteinID: XP_019843900
UniProt: A0A6P5E381
LinkDB
Position
25
AA seq 472 aa
MGTERGRVWAAGAHLLQTGWGFSPTQGAWSQPIPLGCPAPPWSPQGSFSQACPVTGGQRQ
ALPLPWPCPKAATVNLPRSLFPGPGPGAFTCYNNNILRIECRWPGPALGQGAGSWLLFTS
NVVPGSKHKCVFWAGVCTVELPPEEVLVPADNFTITFHHHISGKEQVSLVDPQYLPRRHV
KLDPPSDLQSNVSSEHCVLTXSVSPALEPLAMLLSYELAFKRQEEAWEWARHKDHIVGVT
WLKLEAAELDPGSAYEARLRVQMAALEGEVAEEERYEGVWSDWSQPACFAAPPRRGRLVP
ALGQSDSTLVAVSLFLLLSSLIYLLFKLSPRMKTALYKDVPSPGPFFQPLYSVHNGDFQT
WIGARGASPQAGRDHAGPPRGALLEARVREAVALLHCDPADAWPSVGLEEEGGPGPGLPA
GVLPAGHVEWGVPSPAYLPQEDWAPAGRPRLAPPRCEGSSGDYCALDCSVGS
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgggcacagagcggggcagggtctgggctgcgggtgcccatcttctgcagaccggttgg
ggcttcagccccacccagggcgcatggtcacagcccatccccttagggtgcccagccccg
ccgtggtcacctcagggctccttctctcaggcctgccctgtcacagggggtcagcgccaa
gccctccccctcccctggccctgccccaaggcagccacggtgaacttgccacggtcactg
ttcccagggccagggcctggggctttcacctgctacaataacaacatcctcaggattgag
tgccgctggcctggcccagcgctgggccagggggccggctcctggctgctcttcaccagc
aacgtcgtgccgggcagcaagcacaagtgtgtcttctgggccggcgtgtgcaccgtggag
ctgccgcccgaggaggtcctcgtgcctgctgacaacttcaccatcaccttccaccaccac
atctccgggaaggagcaggtcagccttgtggatccacagtatctgccccggagacacgtg
aagctggaccccccctcggacttgcagagcaacgtcagctctgagcactgtgtcctgacc
tkgagcgtcagtcctgccttggagccgctggccatgctcctcagctatgaactggccttc
aagaggcaggaggaagcctgggagtgggctcggcacaaggatcacatcgttggggtgacc
tggctcaaacttgaagccgccgagttggaccctggttctgcctatgaggcccggctgcga
gtccagatggctgccctagagggcgaggtggcggaggaggagcgatacgagggcgtgtgg
agtgactggagccagcctgcctgctttgccgctccccccagacgaggtcgcctggtccct
gctctggggcagtctgatagcaccctggtcgctgtgtccctcttcctcctgctgagcagc
ctgatctacttactgttcaaactgtcgcccaggatgaagacagctttgtacaaggatgtg
ccgtccccaggcccattcttccagcctctgtacagcgtgcacaacggggacttccagacc
tggataggggcccgcggagccagcccacaggctggccgggaccatgccggcccmccacga
ggagccctcctggaagcccgtgtccgggaggccgtcgctttgctgcactgtgacccagca
gacgcctggccgtcggtgggcctggaggaggagggcggccctgggcccggcctcccrgca
ggtgtgctgccagcaggacacgtggagtggggggtgccgtcgcccgcctacctgccacag
gaggactgggcccctgcgggccgcccccggctggcgcccccccggtgcgagggcagcagt
ggcgactactgtgccctggactgctctgtggggagctga

KEGG   Bos indicus (zebu cattle): 109578841
Entry
109578841         CDS       T04792                                 

Gene name
IL21R
Definition
(RefSeq) interleukin-21 receptor
  KO
K05075  interleukin 21 receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04659  Th17 cell differentiation
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109578841 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109578841 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109578841 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    109578841 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109578841 (IL21R)
   04090 CD molecules [BR:biu04090]
    109578841 (IL21R)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL2 receptor family
   109578841 (IL21R)
CD molecules [BR:biu04090]
 Proteins
  109578841 (IL21R)
SSDB
Motif
Pfam: EpoR_lig-bind IL4Ra_N
Other DBs
NCBI-GeneID: 109578841
NCBI-ProteinID: XP_019843914
UniProt: A0A6P5E0R5
LinkDB
Position
25
AA seq 531 aa
MPCAWAATLLLLMLQGTWGCSNLVCYTDYIETITCILDTWARHPDSLTLTWHDTYGELED
EVTSCSLLRSTHNATHVEYTCHMNVFRLMADDFFNVSMTDPSGNYSQECGSFIVAASIKP
SPPFNVTVNFSGYYNVSWSSSSSFSPSDRVYALKDKLQYELRYRKVGEPWAQSPGRKLIS
EDSRSVFLLPLEFHSGSSYELQVRAGPQPGSTFQGTWSEWSDPVVFHTQPEERKGDLYLH
LVPIPLILVCLIFVFLGLKVPWRPWEKVWLQVSSPKPFFQPLYVGHSGDFKKWVGTPFTA
SSLELRPWSPGVHLALEMCSPCPPQGVVKGLVPTELPEPTDLVEADGVPEPGSWGPVPST
AGSLGSSVYSQEKDRLYGLVSIDTVTVVDAEGLCGWPCTCGDDGYPALNLDTGLEPGPDT
EDRLLSTGTTILSCGCVSAGGPMRPGSLLDRLRLSXEDEADWTPGPSDSEAGSPPVGLDM
NTFDSGFADSDCGSPVESDFSSPRDEEPPRSYLRQWVVMAPPPTPPGSQAS
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgccgtgtgcctgggctgcgactttgctcctgctaatgctccagggaacctggggctgc
tccaacctcgtctgctacaccgattacatcgagactatcacctgcatcctggacacatgg
gccaggcaccccgactcgctcaccctcacctggcatgacacatatggagaactggaggat
gaagtcacctcctgcagcctcctccggtccacccacaacgccacccacgtggagtacacg
tgccacatgaatgtgttccgcctcatggctgacgacttcttcaatgtaagcatgacagac
ccatccggcaactactcccaggagtgtggcagctttatagtggctgcgagcatcaagcca
tctccccctttcaacgtgaccgtgaacttctccggatattataatgtytcttggagttcc
agttccagtttcagtcccagtgaccgtgtctatgcrctgaaggacaaacttcagtatgag
ctgcggtacaggaaggttggagagccctgggctcagagtccagggagaaagctgatctca
gaggattccagaagcgtctttctcctccctttggagttccacagtgggtcaagctacgag
ctgcaggtgcgggcagggccccagcccggctccaccttccaggggacctggagcgaatgg
agtgacccagtcgtctttcacacccagccggaagagagaaagggagacctgtatcttcac
ctggttcccatcccgctcatcctggtctgcctcatctttgtcttcttgggcctgaaggtc
ccttggaggccgtgggaaaaggtatggttgcaggtgtccagcccaaagcccttcttccag
cccctgtacgtgggccacagcggagacttcaagaaatgggtgggcacacccttcactgcc
tccagcctggagctgaggccctggagcccaggggtgcacttggcccttgagatgtgcagc
ccatgcccaccgcagggtgtagtcaaggggctggtgcccacggagctgccggagcccaca
gacctggtggaagctgacggagtgcctgagccgggctcctggggcccagtgccctccacy
gccggcagcttgggcagctcggtttacagccaggagaaggaccggctgtayggcctggta
tccatcgacacggtgactgtggtggacgcggaggggctgtgtggctggccctgcacctgt
ggggacgatggctaccctgccctaaacctggacactggcctggagcctggtccggacaca
gaggaccggctcctgagcacggggaccacgatcctgtcttgtggctgtgtctcggccggt
ggccccatgaggccgggcagcctccttgaccggctaaggctgtcccrtgaggatgaggca
gattggacacctgggccgtcggacagcgaggcgggctcgcccccggtcggcctggacatg
aacacgtttgacagyggcttcgcggactctgactgtggcagccccgtggagagtgacttc
agcagccccagggacgaggaaccccccaggagctacctccgacagtgggtggtcatggcc
cctccacctacgccgccggggtcccaggccagctag

DBGET integrated database retrieval system