KEGG   Bos indicus (zebu cattle): 109554314
Entry
109554314         CDS       T04792                                 

Gene name
GAB2
Definition
(RefSeq) GRB2-associated-binding protein 2
  KO
K08091  GRB2-associated-binding protein 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04014  Ras signaling pathway
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04380  Osteoclast differentiation
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109554314 (GAB2)
   04072 Phospholipase D signaling pathway
    109554314 (GAB2)
   04071 Sphingolipid signaling pathway
    109554314 (GAB2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    109554314 (GAB2)
   04666 Fc gamma R-mediated phagocytosis
    109554314 (GAB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109554314 (GAB2)
 09160 Human Diseases
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109554314 (GAB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:biu04990]
    109554314 (GAB2)
Domain-containing proteins not elsewhere classified [BR:biu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   109554314 (GAB2)
SSDB
Motif
Pfam: PH PH_9 PH_2 PH_11 PH_13
Other DBs
NCBI-GeneID: 109554314
NCBI-ProteinID: XP_019810235
UniProt: A0A6P5BJJ9
LinkDB
Position
29
AA seq 640 aa
MSGDPDVLEYYKNDHSKKPLRIINLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLV
AETEEDMNKWVQSICQICGFNQAEESTDSLRNISSAPHGPRSSPAELSSSSQHLLRERKA
SAPSHSSQPTLFTFEPALSNHVQPALSASAPQEYLYLHQCISRRAESTRSASFSQGSRAS
FLMRSDTAVQKLAQGNGHCVNGVGGQVHGFYSLPKPSRHNTEFRDSAYDLPRSLAAHGHT
KGSLTGSETDNEDVYTFKTPSSTLCREFGDLLVDNVDVPTTPLSAYQIPRTFTLDKNHNA
MAVATPGDSAIAPPPRPPKPSQADTPRWGSPQQRPPTGEGSRSVSAAATIPRRNTLPAMD
NSRLHRASSCESYDYPQRGGDSAGRSAESMSDAVSAFLPAKAVVGRSDSTNSEDNYVPMN
PGSSTLLALERAGDNSQSVYIPMSPGPHHFDPLGYPSSALSLHRGSSRGSEIQPPPVNRN
LKPDRKAKPTPLDLRNNTVIDELPFKSPITRSWSRAIHSFSPSSSQYCRPISTQSITSTD
SGDSEENYVPMQNPVSASPIPSGTNSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVT
SDEKVDYVQVDKEKTQALQNTMQEWTDVRQSSEPSKGAKL
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgagcggtgaccccgacgtcctggaatactacaagaacgatcactccaagaagcccctg
cgcatcatcaacctgaacttctgcgagcaggtggatgccggcctgaccttcaacaagaag
gagctgcaggacagcttcgtgttcgacatcaagaccagcgagcgcaccttctacctggtg
gccgagacggaggaggacatgaataagtgggtccagagcatctgccagatctgcggcttc
aaccaggcagaagagagcacagactccctgcggaacatctcctcggccccgcacgggccg
cgctcctctccagcsgagctcagcagctccagccagcaccttctccgagagcggaaagcc
tcggccccgtcgcactccagccagccgaccctgttcaccttcgagcccgcgctgtccaac
cacgtgcagcccgccctgtccgccagcgcgcctcaggagtacctctatctgcaccagtgc
atcagccgcagggcggagagcacacggagtgccagcttctctcagggctccagggcctcg
ttcctcatgaggagcgacacagctgtgcagaaacttgcccagggcaacgggcactgtgtc
aacggggtcggtggtcaagtccacggcttctacagcctcccgaagccaagccggcacaac
acagagttcagagacagtgcctacgacctccccaggagcctggccgcccacggccacacc
aagggcagcctcaccggctccgagacagacaacgaggatgtgtataccttcaagacgccc
agcagcaccctgtgccgggagtttggggacctcctggtggacaacgtggacgttccaacc
accccgctctcggcctaccagatccctaggacgttcacgctggacaagaaccacaacgcc
atggcagtggccacgcctggggactcggccatagctcccccgccccggccccccaagccg
agtcaggcagacacacctcgatggggcagccctcagcagagacctcccaccggggaaggc
agcagatcggtctctgccgccgccaccatccccaggcgtaacaccctcccagccatggac
aacagccggcttcaccgagcttcctcctgcgagtcctacgactacccgcagcgtggtgga
gacagtgccggccggtctgccgagtccatgagcgatgcagtcagcgctttcctgccagcg
aaagcagtcgtgggtcgatcagacagcaccaattccgaggacaactacgtgcccatgaac
ccaggctcctccaccctgctggctttggagcgagccggtgataactcccagagtgtctac
atccccatgagccccgggccgcaccactttgacccgctcggctacccctcctcagccctc
tctctgcaccgaggctccagcagagggagtgagatccagccaccccctgtcaaccgcaac
ctcaaacctgaccggaaggcaaagccaacaccacttgacctgagaaacaacaccgtcatc
gatgagctccccttcaagtcccccatcaccaggtcttggtccagggccatccactccttc
agccccagctcttcccagtactgccgccccatctctacacagagcatcaccagcaccgac
tccggagacagtgaagagaactacgtccctatgcaaaaccccgtgtctgcatctcccatt
cccagcggcaccaacagcccagcccctaagaagagcactggcagtgtggattatctggcc
ctggacttccagccgagctccccgagcccccaccgcaagccatccacatcatcggtcact
tccgacgagaaggtggactacgttcaagtggacaaggagaagacccaggccctgcagaat
accatgcaggagtggacagacgtgcggcagtcctcggagccctccaagggcgcaaagctg
tga

DBGET integrated database retrieval system