KEGG   Bos indicus (zebu cattle): 109554353
Entry
109554353         CDS       T04792                                 

Gene name
FZD4
Definition
(RefSeq) frizzled-4
  KO
K02354  frizzled 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109554353 (FZD4)
   04390 Hippo signaling pathway
    109554353 (FZD4)
   04150 mTOR signaling pathway
    109554353 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109554353 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109554353 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109554353 (FZD4)
   05205 Proteoglycans in cancer
    109554353 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109554353 (FZD4)
   05226 Gastric cancer
    109554353 (FZD4)
   05217 Basal cell carcinoma
    109554353 (FZD4)
   05224 Breast cancer
    109554353 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109554353 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    109554353 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109554353 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109554353 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109554353 (FZD4)
   04090 CD molecules [BR:biu04090]
    109554353 (FZD4)
G protein-coupled receptors [BR:biu04030]
 Frizzled / Smoothened family
  109554353 (FZD4)
CD molecules [BR:biu04090]
 Proteins
  109554353 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 109554353
NCBI-ProteinID: XP_019810329
UniProt: A0A6P5BJZ2
LinkDB
Position
29
AA seq 537 aa
MAWRGAGPRVLGGPGGVGLSPRLLLLLLLLVEPVRGFGDEEERRCDPIRISMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKVNIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDVWMAVWASLCFISTAFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGRGNETVV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggcctggcggggcgcagggccgcgcgtcctggggggccccgggggcgtcgggctcagt
ccacggctgttgctgctgctgctactgctcgtggagccggtgcggggcttcggggacgag
gaggagaggcgctgcgaccccatccgcatctccatgtgccagaacttgggctacaacgtg
accaagatgcccaacctggtggggcacgagctgcagacggacgccgagctgcagctgacc
acattcacgccgctcatccagtacggctgctccagccagctgcagttcttcctttgttcc
gtgtatgtgcccatgtgcacagagaaggtcaacatccccatcgggccctgcggcgggatg
tgcctttctgtcaagagacgctgcgagcctgtgctgaaggagtttggctttgcctggccg
gagagcctaaactgcagcaaattcccgccccagaacgaccacaaccacatgtgcatggaa
gggccaggtgatgaggaagtgcccttgcctcacaaaacccccatccagcctggggaagag
tgccactccgtgggaaccaactcggatcagtacatctgggtgaaaaggagcctgaactgt
gttctcaagtgtggctacgacgctggcttgtacagccgctcggccaaggagttcaccgac
gtctggatggccgtgtgggccagcctgtgcttcatctccaccgccttcactgtgctcacc
ttcctgattgattcttccaggttttcctacccagagcgccccatcatctttctcagtatg
tgctataatatttatagcattgcttatattgtcaggctgactgtaggccgggaaaggata
tcctgcgattttgaagaggcagcagaacctgttctcattcaagaaggccttaagaacaca
ggatgtgcaatcattttcttgctgatgtacttttttggaatggccagttccatctggtgg
gttattctgacgctcacttggtttttggcagcgggactcaaatggggtcatgaagccatc
gaaatgcacagctcttatttccacatcgcagcctgggccatccccgcggtgaaaaccatt
gtcatcttgattatgagactggtggacgcrgatgagctgactggcctgtgctacgtgggg
aaccagaacctggatgcactcacgggctttgtggtggccccgctgttcacctacctggtg
attgggactttgttcattgctgcggggttggtggccttgttcaaaattcggtcgaatctt
caaaaggatgggacgaagacagacaagttggaaaggctgatggtgaagatcggggtcttc
tcggtcctgtacacagtgcctgcaacctgcgtgattgcctgttatttctatgaaatctcc
aactgggcgcttttccggtattccgcagatgactccaacatggcagtggaaatgttgaaa
atctttatgtctttgctggtgggcatcacttcaggcatgtggatttggtctgccaaaact
ctgcacacgtggcagaagtgttccaacagattggtgaattctgggaaggtaaagagagag
aaaagagggaatggctgggtgaagcctgggagaggtaatgagactgtggtataa

KEGG   Bos indicus (zebu cattle): 109558182
Entry
109558182         CDS       T04792                                 

Gene name
FZD1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109558182 (FZD1)
   04390 Hippo signaling pathway
    109558182 (FZD1)
   04150 mTOR signaling pathway
    109558182 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109558182 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109558182 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109558182 (FZD1)
   05205 Proteoglycans in cancer
    109558182 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109558182 (FZD1)
   05226 Gastric cancer
    109558182 (FZD1)
   05217 Basal cell carcinoma
    109558182 (FZD1)
   05224 Breast cancer
    109558182 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109558182 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    109558182 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109558182 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109558182 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109558182 (FZD1)
G protein-coupled receptors [BR:biu04030]
 Frizzled / Smoothened family
  109558182 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 109558182
NCBI-ProteinID: XP_019815203
UniProt: A0A6P5BA39
LinkDB
Position
4
AA seq 645 aa
MAEEEAPKKSRAAGGGGGGGSWELCAGALRTVPAAEGSGDAGSRRRPPADSRRLARRLLL
LLWLLEAPLLLGVRSQAAGQGPGPGQQPPPPQQQQSGQQYNGERGISIPDHGYCQPISIP
LCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQ
ALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSL
LPEFWTSNPQHGGGGHRGGGFAGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCE
PTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGC
YTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWV
ILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGL
NNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFS
VLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGAPPHPPMSPDFTV
FMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1938 nt   +upstreamnt  +downstreamnt
atggctgaggaggaggcgcctaagaagtcccgagccgccgggggcggcggcggcggcggg
agctgggaactttgtgccggggcgctccgcactgtaccggcggcggaagggagcggggac
gcgggcagccgccgccgccccccggctgactcccggcgcttggcgcgccggctactacta
ctgctttggctgctggaggctccgctgctgctgggggtccggtcgcaggcggccggccag
gggcccgggccggggcagcagcccccgccgcctcagcaacagcagagcgggcagcagtac
aacggcgagcggggcatctctataccggaccacggttactgccagcccatttccatcccg
ctgtgcaccgacatcgcgtacaatcagaccatcatgcccaacctgctgggccacacgaac
caggaggatgcgggcctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttcc
gccgagctcaagtttttcctgtgctccatgtacgcgcccgtgtgcaccgtgctggagcag
gctctgccgccctgccgctcgctgtgcgagcgcgcgcgccagggctgcgaggcgctcatg
aacaagttcggcttccagtggcccgacacgctcaagtgcgagaagttcccggtgcacggc
gccggcgagctgtgcgtgggccagaacacgtcggacaagggcaccccgacgccctcgctg
ctgcccgagttctggactagcaacccccagcacggaggcggaggtcaccggggcggcggc
ttcgcggggggcgccggagcttcggagcgaggcaagttctcgtgcccgcgcgccctcaag
gtgccctcctacctcaactaccacttcctgggggagaaggactgcggcgccccctgcgaa
ccgaccaaggtgtacgggctcatgtacttcgggcccgaggagctgcgcttctcacgcacc
tggatcggcatctggtcagtgctatgctgcgcctccacgctcttcaccgtgcttacctac
ctggtggacatgcggcgcttcagctaccctgagcggcccatcatcttcctgtcgggctgc
tacacggcggtggccgtggcctacattgccggcttcctgctggaggaccgggtggtgtgt
aacgacaagttcgcggaggacggggcgcgcaccgtggcacaggggaccaagaaggagggc
tgcaccatcctcttcatgatgctgtacttcttcagcatggccagctccatctggtgggtg
atcctgtcgctcacctggttcctggcagccggcatgaagtggggccacgaagctatcgag
gcgaactcgcagtattttcacctggccgcctgggccgtgccggccatcaagaccatcacc
attctggcgctgggccaggtggacggtgatgtgctaagcggggtgtgcttcgtggggctc
aacaacgtggacgctctgcgcggcttcgtgctggcgcccctcttcgtgtacctgttcatc
ggcacgtcgttcctcctggccggcttcgtgtccctcttccgcattcgcaccatcatgaag
cacgacggcaccaagaccgagaagctggagaagctcatggtgcgcatcggcgtcttcagc
gttctctacactgtgccggccaccatcgtcatcgcctgctacttctacgagcaggccttc
cgggaccagtgggagcgcagctgggtggcccagagctgcaagagctatgccatcccctgc
ccccacctccaggcgggcggcgccccgccgcacccgcccatgagccccgacttcacagtc
ttcatgatcaagtaccttatgaccctcatcgtgggcatcacgtcaggcttctggatctgg
tccggcaagaccctcaactcctggaggaagttctacactcggcttaccaacagcaaacag
ggggagaccaccgtctga

KEGG   Bos indicus (zebu cattle): 109562801
Entry
109562801         CDS       T04792                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3
  KO
K02329  frizzled 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109562801 (FZD3)
   04390 Hippo signaling pathway
    109562801 (FZD3)
   04150 mTOR signaling pathway
    109562801 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109562801 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109562801 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    109562801 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562801 (FZD3)
   05206 MicroRNAs in cancer
    109562801 (FZD3)
   05205 Proteoglycans in cancer
    109562801 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109562801 (FZD3)
   05226 Gastric cancer
    109562801 (FZD3)
   05217 Basal cell carcinoma
    109562801 (FZD3)
   05224 Breast cancer
    109562801 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109562801 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    109562801 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109562801 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109562801 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109562801 (FZD3)
G protein-coupled receptors [BR:biu04030]
 Frizzled / Smoothened family
  109562801 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 109562801
NCBI-ProteinID: XP_019821388
UniProt: A0A6P5C7I8
LinkDB
Position
8
AA seq 666 aa
MAMSRIVFYLWPLTMFVGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGDPTEGASVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYXASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRSIWEXTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGXRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgagtaggatcgtcttctatctgtggcccttgactatgtttgtgggccatata
ggtgggcacagtttgttttcttgtgagcctattaccttgaggatgtgccaagatttgcct
tataacactaccttcatgcccaatcttctgaatcattatgaccaacagacggcagcttta
gcaatggagccattccaccctatggtgaatttggattgctctcgggacttccggccattt
ctctgtgcactctatgctcctatctgtatggaatacggacgtgtcacacttccctgccgt
aggctctgtcagcgggcttacagtgagtgttcgaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgacgagccrtatcctcggctg
gtggacctgaatttagctggcgatcctactgaaggagcctcagtggcagtgcagagggac
tacggcttttggtgtccccgagagttgaaaattgatcctgatcttggctattcctttttg
cacgtgcgtgattgttcacctccttgcccaaatatgtactttaggagagaagagctttca
tttgctcggtatttcataggattgatttcaatcatttgcctctctgccacgttgtttact
tttttaacttttttgattgatgtgacaaggttccgttatcctgaaagacccattatattt
tatgccgtctgctacatgatggtgtcattaattttctttattgggtttttgcttgaggac
cgagttgcctgtaacgcatccagccctgcacagtatmaggcttccacagtgacccaagga
tctcataacaaagcctgtaccatgctttttatggtactctacttttttactatggctggc
agcgtttggtgggtgattcttaccatcacatggttcttggcagctgtgccaaagtggggt
agtgaagctattgagaagaaagccttgctgttccacgccagtgcgtggggcatccctgga
actctgaccatcatccttttagcgatgaataaaattgaaggtgacaatataagtggcgtg
tgttttgttggcctctacgatgttgatgccttgaggtattttgttcttgcacccctctgc
ctgtatgtggtagttggggtttcactacttttagccggcattatatccctaaacagagtg
cgaattgagattccattagaaaaggagaaccaggataaactggtgaagtttatgatccgg
attggtgttttcagcattctgtatctcgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccgaagcatctgggaaryaacgtggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggttactcaaatgagtcgtccagacctgattctcttt
ctgatgaaatacctgatggctctcatagttggtattccttccattttttgggttggaagt
aaaaagacttgctttgaatgggccagttttttccacggtcrtaggaaaaaagagatagtg
aacgagagccgacaggtactccaggaacctgattttgctcagtccctcctgagggatcca
aatactcctataataaggaaatcaagaggaacttccactcaagggacatccacacatgct
tcttcaacrcagctggccatggtggatgaccagaggagcaaagcaggtagtgtccacagc
aaagtgagcagctaccayggcagcctccacaggtcccgggacggcaggtacactccctgc
agttacagaggaatggaggagagactacctcatggcagcatgtcacgacttacagatcac
tccaggcacagtagttcccatcggctcaatgaacagtcacgacatagyagcatcagagat
ctcagtaataatcctatgactcacatcacacatggtaccagcatgaatcgggttattgaa
gaagatggaaccagtgcttaa

KEGG   Bos indicus (zebu cattle): 109567602
Entry
109567602         CDS       T04792                                 

Gene name
FZD8
Definition
(RefSeq) LOW QUALITY PROTEIN: frizzled-8
  KO
K02375  frizzled 5/8
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109567602 (FZD8)
   04390 Hippo signaling pathway
    109567602 (FZD8)
   04150 mTOR signaling pathway
    109567602 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109567602 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109567602 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109567602 (FZD8)
   05205 Proteoglycans in cancer
    109567602 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109567602 (FZD8)
   05226 Gastric cancer
    109567602 (FZD8)
   05217 Basal cell carcinoma
    109567602 (FZD8)
   05224 Breast cancer
    109567602 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109567602 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    109567602 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109567602 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109567602 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109567602 (FZD8)
G protein-coupled receptors [BR:biu04030]
 Frizzled / Smoothened family
  109567602 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2
Other DBs
NCBI-GeneID: 109567602
NCBI-ProteinID: XP_019828192
UniProt: A0A6P5CTM7
LinkDB
Position
13
AA seq 626 aa
GAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPD
LKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGN
PDTXXXXXXXXXXXXXXXXXLRAXGGGGGGSGGKARPPGGGAAPCEPGCQCRAPMVSVSS
ERHPLYNRVKTGQIANCALPCHNPFFSQPERAFTVFWIGLWSVLCFVSTFATVSTFLIDM
ERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAGAAGGAGGAGGAAAGAGAA
GAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFL
AAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRG
FVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVP
AAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVW
VWSGKTLESWRALCTRCCWASKGAGAAGAGAAGGGPGGGGPGAGGGGGPGAGGAGSLYSD
VSTGLTWRSGTASSVSYPKQMPLSQV
NT seq 1881 nt   +upstreamnt  +downstreamnt
ggtgcggcggccgcctcagccaaggaactggcgtgccaggagatcaccgtgccgctgtgc
aagggcatcggctacaactacacctatatgcccaaccagttcaaccacgacacgcaggac
gaggcgggcctggaggtgcaccagttctggccgctggtggagatccagtgctcgcccgac
ctcaagttcttcctgtgcagcatgtacacgcccatctgcctagaggactacaagaagccc
ctgcctccctgccgctcggtgtgcgagcgcgccaaggccggctgcgcgcccctcatgcgc
cagtacggcttcgcctggcccgaccgcatgcgctgcgaccggctgcccgagcagggcaac
cccgacacgnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
ctgcgcgcgngcggcggcggcggcggtggcagcggcgggaaggcgcggccccctggcggc
ggcgcggcgccctgcgagccgggatgccagtgccgcgcgcccatggtgagcgtgtccagc
gagcggcaccctctctacaaccgcgtcaagacgggccagatcgccaactgcgcgttgccc
tgccacaacccgttcttcagycaaccngagcgcgccttcaccgtcttctggataggcctg
tggtctgtactatgcttcgtgtccaccttcgccaccgtctccaccttcctcatcgacatg
gagcgcttcaagtacccggagcggcccatcatattcctctcggcctgctaccttttcgtg
tctgtcggctacctggtgcgcctggtggcgggccacgagaaggtggcgtgcagcggcggc
gctggggctgcgggcggggccggaggcgcggggggcgcggcggcgggcgcgggtgcggcg
ggagccggcgctgggggcccaggtgggcgcggagagtatgaggagctgggcgccgtggag
cagcacgtgcgctacgagaccaccggcccggcgctgtgcaccgtggtcttcctgctcgtc
tacttcttcggcatggccagctccatctggtgggtgatcctgtcgctcacgtggttcctg
gcggcgggcatgaaatggggcaacgaggccatcgccggctactcgcagtacttccacctg
gccgcgtggctcgtgcccagcgtcaagtctatcgccgtgctggcgctcagctcggtggac
ggcgacccggtggcaggcatctgctacgtaggcaaccagagcctggacaacttgcgcggc
ttcgtgctggcgccgctggtcatctacctcttcatcggcaccatgttcctgctggccggc
ttcgtgtcgctcttccgcatccgctcggtcatcaagcagcaaggtggccccaccaagacg
cacaagctggagaagctcatgatccgcctgggcctcttcaccgtgctctacaccgtgccc
gccgccgttgtggtcgcctgcctcttctacgagcagcacaaccgcccgcgctgggaggcc
acgcacaactgcccgtgcctgcgggatctacagcccgaccaggcgcgccggcccgactac
gcggtcttcatgctcaagtacttcatgtgcctggtagtgggcatcacctcgggcgtgtgg
gtctggtccggcaagacgctcgagtcgtggcgcgcgctgtgcacccgctgctgctgggcc
agcaagggcgcgggcgcggcgggcgcgggcgcggcgggcggcggcccggggggcgggggg
ccgggggccggcgggggcgggggaccgggggccggcggggcgggctccctctacagcgac
gtcagcaccggcctgacgtggcgatctggcacggccagctcggtgtcttatccaaagcag
atgccattgtcccaggtctga

KEGG   Bos indicus (zebu cattle): 109568539
Entry
109568539         CDS       T04792                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6
  KO
K02376  frizzled 6
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109568539 (FZD6)
   04390 Hippo signaling pathway
    109568539 (FZD6)
   04150 mTOR signaling pathway
    109568539 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109568539 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109568539 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109568539 (FZD6)
   05205 Proteoglycans in cancer
    109568539 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109568539 (FZD6)
   05226 Gastric cancer
    109568539 (FZD6)
   05217 Basal cell carcinoma
    109568539 (FZD6)
   05224 Breast cancer
    109568539 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109568539 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    109568539 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109568539 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109568539 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109568539 (FZD6)
G protein-coupled receptors [BR:biu04030]
 Frizzled / Smoothened family
  109568539 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec Integrin_alpha RseC_MucC
Other DBs
NCBI-GeneID: 109568539
NCBI-ProteinID: XP_019829459
UniProt: A0A6P5CUS7
LinkDB
Position
14
AA seq 714 aa
METFTFLWTCIFLPLVRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEI
FLPLANLECSPNVETFLCKAFVPTCTEQIHVVPPCRKFCEKVYSDCKKLMDTFGIRWPEE
LECDRLQYCDESVPATFNPHTELLGPHKKSEQIRRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGNSTACNKADEKLELGDTVVLGSQNKACTILFMFLYFFTMAGTVWW
VMLTITWFLAAGRKWSCEAIEQNAVWFHAVAWGIPGFLTIMLLAMSKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQANTETRPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKKDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITNHDYLGQETLTEIQTSPETSVREV
RGDGASTPKLRERDCEEPASSAAPSSKLCGEQMDKKGHGRAGKVNDKSSVSESARSEGRV
TPKSDVPESGPVQSNSMQASSSPEPSSLKGSTSLLVHSASGVGKEQGAGGRSDT
NT seq 2145 nt   +upstreamnt  +downstreamnt
atggaaacatttacatttttgtggacatgtatttttctacccctggtaagagggcacagt
cttttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgaca
tttttccctaatctgatgggtcattatgaccagagtattgctgctgtagaaatggagatt
tttcttcctcttgcaaatctggaatgttcaccaaatgttgaaactttcctttgcaaagct
tttgtaccaacctgcactgagcaaattcatgtggttccaccctgtcggaaattttgtgag
aaagtgtattctgattgcaagaaattaatggacacttttgggatccgatggcctgaggaa
cttgagtgtgatagattacagtactgtgatgagtctgttcctgcaacttttaacccacac
acagagcttcttggtcctcacaagaaatcagaacaaatccgaagagacattggattttgg
tgtccaaggcatcttaagacttctgggggacaaggctataagtttctgggaattgaccaa
tgtgcacctccatgccccaacatgtattttaaaagcgatgagctagagtttgcaaaaagt
tttattggaatagtttcaatattttgcctctgtgcaacgcttttcacattccttactttt
ttaattgatgttagaagattcagatacccagagcgacctattatatattactctgtctgt
tacagcattgtatctcttatgtactttatcggattcttgctaggcaacagcacagcgtgc
aataaggcagatgagaaactggaacttggtgacacagttgttctaggctctcaaaataag
gcttgcaccattctgttcatgtttttgtattttttcaccatggctggcactgtgtggtgg
gtgatgctcaccattacttggttcttagctgctggcagaaaatggagttgtgaggccatt
gaacaaaacgcagtgtggtttcatgctgttgcgtggggaataccaggttttctcaccatt
atgcttcttgccatgagcaaagttgaaggagacaacattagcggcgtctgctttgtcggc
ctctatgacctggatgcttcgcgctacttcgtcctcttgccactctgcctctgtgtgttt
gtcgggctgtctcttctcttagctggcattatttccttaaatcacgttcgacaagttata
caacacgatggccggaaccaagagaaactgaagaagtttatgattcgaattggagtcttc
agtggcctgtatctcgtgccattagtaactcttctgggatgctacgtctacgagcaagta
aacaggattacctgggagataacttgggtctctgaccactgtcgtcagtaccacatccca
tgtccttatcaggcaaatacagaaactcgaccagaattggctttatttatgataaaatat
ctgatgacattaattgttggcatctctgctgtcttctgggttggaagcaaaaagacatgc
acagaatgggctggattttttaaacgaaatcgcaagaaagatccaatcagtgaaagtcga
agagtgttacaggagtcatgtgagtttttcttaaagcacaactctaaagttaaacacaaa
aagaagcactacaagccaagttcacataaactgaaggtcatttccaaatccatgggaacc
agcacaggagcgacggcaaatcatggtacttctgcagtagcaatcactaaccatgattac
ttaggacaagaaactctgacagaaatacaaacttcaccagaaacatcagtgagagaggtg
agaggggatggagcgagtacccccaaattaagagaacgggactgtgaggagcctgcctcc
tcagcagcacccagctccaaactctgcggggagcagatggacaagaaaggccacggccgg
gcaggcaaggtgaatgacaagagcagtgtgtctgaaagtgcgcggagtgaaggaagggta
accccgaagagtgatgtccccgaaagtggcccagtgcagagcaacagcatgcaggcgtcc
agttctccagagccaagcagcctcaaaggctcaacatcactgcttgttcactcggcttca
ggagttggaaaagagcagggcgctggcggtcgttcagatacttga

KEGG   Bos indicus (zebu cattle): 109569613
Entry
109569613         CDS       T04792                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109569613 (FZD7)
   04390 Hippo signaling pathway
    109569613 (FZD7)
   04150 mTOR signaling pathway
    109569613 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109569613 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109569613 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109569613 (FZD7)
   05205 Proteoglycans in cancer
    109569613 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109569613 (FZD7)
   05226 Gastric cancer
    109569613 (FZD7)
   05217 Basal cell carcinoma
    109569613 (FZD7)
   05224 Breast cancer
    109569613 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109569613 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    109569613 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109569613 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109569613 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109569613 (FZD7)
G protein-coupled receptors [BR:biu04030]
 Frizzled / Smoothened family
  109569613 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 109569613
NCBI-ProteinID: XP_019830718
UniProt: A0A6P5CYC2
LinkDB
Position
2
AA seq 574 aa
MRGSRAAASRLPLDLCTVVLALLGSLPAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEEAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDKAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGGPTAYP
TAPYLPDLPFTALPPGAADGRGRSAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgcggggctcccgcgcggcggcgtcgcgcttgcctctggacctttgcaccgtggtgctg
gcgctgctgggctcactgcccgcgggcgccggggcgcagccgtaccacggagagaagggc
atctcagtgccagaccacggcttctgccagcccatctccatccccctgtgcacggacatc
gcctacaaccagaccatcctgcccaacctgctgggtcacacgaaccaagaggaagcgggc
ctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttcwcccgagctgcgcttc
ttcctctgctccatgtacgcacccgtgtgtacagtgctcgacaaggccatccctccgtgc
cgctctctgtgcgagcgtgcccgccagggctgtgaggcactcatgaacaagttcggtttc
caatggcctgagcggctgcgttgcgaaaacttccccgtgcacggcgctggcgagatctgc
gtgggccaaaacacgtcggacggctccgggggcgcgggcggcggccccaccgcctaccct
accgcaccctacctgcccgacctgcccttcaccgcgctgcctccgggggccgctgacggc
cggggccgctccgctttccccttctcgtgcccccgccagctcaaggtacccccctacctg
ggctaccgcttcctgggcgagcgcgactgcggcgccccttgcgagccgggccgcgccaac
ggccttatgtactttaaggaggaggagaggcgcttcgcccgcctctgggtgggcgtgtgg
tctgtgctgtgctgcgcctcgactctcttcaccgtgctcacctacctagtggacatgcgg
cggttcagctacccggagcggcccatcatcttcctgtcgggctgctacttcatggtggcc
gtggcgcacgtggccggcttcctgctggaggaccgcgcggtgtgcgtggagcgcttctcc
gacgacggctaccgcacggtggcgcagggcaccaagaaggagggctgcacaatcctcttc
atggtgctstacttcttcggcatggccagttccatctggtgggtcatcttgtcgctcact
tggttcctggcggccggcatgaagtggggccacgaggccattgaggccaactcgcagtac
ttccacctggccgcctgggctgtgcccgctgtcaagaccatcaccatcctggctatgggc
caggtggacggggacctgctcagcggggtgtgctatgtgggcctgtccagcgtggacgcg
ctgcggggcttcgtgctggcgcccctgttcgtctacctcttcatcggcacgtccttcctg
ctggcgggcttcgtgtctctcttccgcatccgcaccatcatgaagcacgacggcaccaag
accgagaagctggagaagctgatggtgcgcatcggcgttttcagcgtgctctacacggtg
ccggccaccatcgttctggcctgctacttctatgagcaggccttccgcgaacactgggaa
cgcacctggctcctgcagacgtgcaagagctacgcggtgccctgcccgcccggccacttc
ccgcccatgagccccgacttcaccgtcttcatgatcaagtacctgatgaccatgatcgtm
ggcatcaccactggcttctggatctggtcgggcaagaccctgcagtcgtggcgccgcttc
taccacagactcagccacagcagcaagggggagactgcggtatga

KEGG   Bos indicus (zebu cattle): 109570198
Entry
109570198         CDS       T04792                                 

Gene name
FZD5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109570198 (FZD5)
   04390 Hippo signaling pathway
    109570198 (FZD5)
   04150 mTOR signaling pathway
    109570198 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109570198 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109570198 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570198 (FZD5)
   05205 Proteoglycans in cancer
    109570198 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109570198 (FZD5)
   05226 Gastric cancer
    109570198 (FZD5)
   05217 Basal cell carcinoma
    109570198 (FZD5)
   05224 Breast cancer
    109570198 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109570198 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    109570198 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109570198 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109570198 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109570198 (FZD5)
G protein-coupled receptors [BR:biu04030]
 Frizzled / Smoothened family
  109570198 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 109570198
NCBI-ProteinID: XP_019831542
UniProt: A0A6P5D2C8
LinkDB
Position
2
AA seq 585 aa
MARPDPSAPPSLLLLLLAQLAGRAAAASKAPACQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPVKPTLSGLPGSXASGN
DCAAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDSGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGATAAGDYAEASAALTGRTGPPGPAAAYHKQVSLSHV
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggctcggcctgacccgtccgcgccgccttcgctgctgctgctgctcctggcgcagctg
gcgggcagggcggccgccgcctccaaggccccggcgtgccaggagatcacagtgcccatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcgggcctggaggtgcaccagttttggccgctggtggagatccactgctctccg
gacctgcgttttttcctgtgctccatgtacacgcccatctgcctgccggactaccacaag
ccgctgccgccctgccgctcggtgtgcgagcgcgccaaagccggctgctccccgctcatg
cgccagtacggctttgcctggccggaacgcatgagctgcgaccgccttccggtgctgggc
cgcgacgccgaggtcctgtgcatggattacaaccgcagcgaggccaccacggctcccccc
aggcccttcccggtcaagcccacactctcgggcctgccggggtcgcnngcctcggggaac
gactgcgccgccgggggcccgtcggtgtgcaagtgccgcgagcccttcgtgcccattctg
aaggagtcacacccgctttacaacaaggtgcggacgggccaggtacccaactgcgcggtg
ccctgctaccagccgtccttcagccccgacgagcgcacgttcgccaccttctggatcggc
ctgtggtctgtgctgtgcttcatctccacctccaccacggtggccaccttcctcatagac
atggaacgcttccgctacccggagcgccccatcattttcctgtcagcctgctacctttgc
gtgtcgctgggcttcctggtgcgcctggtcgtgggccatgctagcgtcgcctgcagccgc
gagcacagccacatccactacgagacaacgggccctgcgctatgcactgtcgtcttcctg
ctggtctacttctttggcatggccagctccatctggtgggtcatcctatcgctcacctgg
ttcttggcggccggcatgaagtggggcaacgaggccatcgcgggctacgcgcagtacttc
cacctggccgcgtggctcatccccagcgtcaagtccatcaccgcgctggccctgagctcc
gtggacggggacccggtggccggcatctgctacgtggggaaccagaacctgaactcgctg
cgcggcttcgtgctgggcccgctggtgctgtacctgctggtgggcacgctcttcctcctg
gcgggcttcgtgtcactcttccgcatccgcagcgtcatcaagcagggcggcaccaagacg
gacaagctggagaagctcatgatccgcatcggcatcttcacgctgctctacacggtgccc
gccagcatcgtggtggcctgctacctgtacgaacagcactatcgcgagagctgggaggcc
gcgctcacgtgcgcgtgcccgggcccggactccggccagccgcgcgccaagcccgagtac
tgggtgctcatgcttaagtatttcatgtgcctcgtggtgggcatcacgtcaggcgtatgg
atttggtccggcaagactgtggagtcatggcgacgcttcaccagccgctgctgctgccgt
ccgcggcggggccacaagagcggcggcgccacggccgcgggggactacgccgaggcaagc
gccgcgctcacgggcaggaccgggccccccggccccgccgccgcctaccacaagcaggtg
tcactgtcgcacgtgtag

KEGG   Bos indicus (zebu cattle): 109571551
Entry
109571551         CDS       T04792                                 

Gene name
FZD10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109571551 (FZD10)
   04390 Hippo signaling pathway
    109571551 (FZD10)
   04150 mTOR signaling pathway
    109571551 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109571551 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109571551 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109571551 (FZD10)
   05205 Proteoglycans in cancer
    109571551 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109571551 (FZD10)
   05226 Gastric cancer
    109571551 (FZD10)
   05217 Basal cell carcinoma
    109571551 (FZD10)
   05224 Breast cancer
    109571551 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109571551 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    109571551 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109571551 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109571551 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109571551 (FZD10)
   04090 CD molecules [BR:biu04090]
    109571551 (FZD10)
G protein-coupled receptors [BR:biu04030]
 Frizzled / Smoothened family
  109571551 (FZD10)
CD molecules [BR:biu04090]
 Proteins
  109571551 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 109571551
NCBI-ProteinID: XP_019833652
UniProt: A0A6P5D9K9
LinkDB
Position
17
AA seq 581 aa
MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPARGSGMFPPLLRPQRPHSAQEH
QLKDGGPGRAGCDNPGKFHHVEKSASCAPLCTPGVDVYWSRDDKRFAVVWLAVWSVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGNMDINALTGFVLIPLACYLIIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNVEYWKVLATQHK
CKMNNQTKNLDCLMXTSIPAVEIFMVKIFMLLVVGITSGMWVWTSKTLQSWQNVCSRRFK
KKSRRKPASVITSSGIYKKAQHPPKTHLGKYEIPAQPPTCV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgcagcgtccgggcccccgcctgtggctagtcctgcaggtgatgggctcgtgtgctgcc
atcagctctatggacatggagcggccgggcgacggcaagtgccagcccatcgagatcccg
atgtgcaaggacattggctacaacatgacccgcatgcccaacctgatgggccatgagaat
cagcgcgaggccgccatccagctgcacgagttcgcgccgctggtggagtacggctgccac
ggccacctccgcttctttctgtgctccctgtacgcgcccatgtgcaccgagcaagtctcc
acccccatccccgcctgccgggtcatgtgcgagcaggcccggctaaagtgctccccgatc
atggagcagttcaacttcaagtggcccgactccctkgactgcagcaaactccccaacaag
aacgaccccaattacctgtgcatggaggcgcccaacaacggctcggacgagcccgcgagg
ggctcgggcatgttcccgccgctcttaaggccgcagcgaccccacagcgcgcaggagcac
cagctgaaggatggggggccggggcgagccggctgcgacaacccgggcaagtttcaccac
gtggagaagagtgcgtcgtgcgcgccgctctgcacgcccggcgtggacgtgtactggagc
cgcgacgacaagcgcttcgcggtagtctggctggctgtctggtccgtgctctgcttcttc
tccagcgccttcaccgtgctcaccttcctcatcgacccagcgcgcttccggtaccccgag
cgccccatcatcttcctgtccatgtgctactgcgtctactcggtgggctacatcatccgc
ctctttgcgggcgccgagagcatcgcctgcgaccgggacagcggacagctctatgtcatc
caggagggcctggagagcacgggctgcaccctggtcttcctggtcctttactacttcggc
atggccagctccctgtggtgggtgattctcaccctcacctggttcctggccgcgggcaag
aagtggggccacgaggccatcgaggccaacagcagctacttccatctggccgcctgggcc
attccggccgtgaagaccatcctgatcctggtgatgcgccgggtcgcgggggacgagctg
accggcgtctgctatgtgggcaacatggacatcaacgccctcaccggcttcgtgctcatc
cccctggcctgttacctcatcatcggcacttcctttatcctctcgggcttcgtggccctt
ttccacatccggagggtgatgaaaacgggtggggagaacacggacaagctcgagaaactc
atggtgcggatcggggtcttctccgtgctctacacggtgccggccacttgtgtgattgcc
tgctacttttacgaacgcctcaacgtggagtactggaaagtcctggccacgcagcacaag
tgcaaaatgaacaaccagactaaaaacctggactgtctgatgrccacctccatccccgcg
gtggagatcttcatggtgaagattttcatgctgctggtggtgggcatcaccagtggcatg
tgggtctggacatctaagactctgcagtcctggcagaacgtttgcagccgcaggttcaag
aaaaagagccggagaaaaccggccagcgtgatcaccagcagtggaatttacaaaaaagcc
cagcatccccccaaaacccatttggggaaatatgaaatccccgcccagcctcccacctgt
gtgtaa

KEGG   Bos indicus (zebu cattle): 109574394
Entry
109574394         CDS       T04792                                 

Gene name
FZD2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109574394 (FZD2)
   04390 Hippo signaling pathway
    109574394 (FZD2)
   04150 mTOR signaling pathway
    109574394 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109574394 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109574394 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574394 (FZD2)
   05205 Proteoglycans in cancer
    109574394 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109574394 (FZD2)
   05226 Gastric cancer
    109574394 (FZD2)
   05217 Basal cell carcinoma
    109574394 (FZD2)
   05224 Breast cancer
    109574394 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109574394 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    109574394 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109574394 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109574394 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109574394 (FZD2)
G protein-coupled receptors [BR:biu04030]
 Frizzled / Smoothened family
  109574394 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 109574394
NCBI-ProteinID: XP_019837961
UniProt: A0A6P5DIL3
LinkDB
Position
19
AA seq 565 aa
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARXX
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTP
GGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTXTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgcctgttgctgccgctgctgctactgcccgccgcc
gggccggcccaattccacggagagaagggcatatccatcccggaccacggcttctgccag
cccatctccatcccgttgtgcacggacatcgcctacaaccagaccatcatgcccaacctt
ctgggccacacgaaccaagaggacgccggactggaggtgcaccagttctacccgttggta
aaggtgcagtgctcgcccgaactgcgcttcttcctgtgctcgatgtacgcacccgtgtgc
accgtgctggagcaggccatcccgccgtgccgctccatctgcgagcgcgcgcgcnnnnnc
tgcgaggcgctcatgaacaagttcggtttccagtggccggagcgcctgcgctgcgagcac
ttccctcgccacggcgcggagcagatctgcgtgggccagaaccactcggaggacggcgcg
ccagcgcttcttaccaccgcgccgccgcccggcctgcagccgggtgcggggggcaccccg
ggcggcccgggtggcggcggctcgcccccgcgctatgccacgctggagcacccgttccac
tgtccgcgcgtcctcaaggtgccgtcctatctcagctacaagttcctgggcgagcgcgac
tgcgcggctccctgcgagccggcgcggccggatggctccatgttcttctcacaggaggag
acgcgctttgcgcgcctctggatcctcacctggtccgtgctgtgctgcgcctccaccttc
ttcaccgycaccacgtacctggtggacatgcagcgcttccgctaccccgagcggcccatc
atctttctgtccggctgctacactatggtgtcggtggcctacatcgcgggcttcgtgctc
caggagcgcgtggtgtgtaacgagcgcttctccgaggacggctaccgcacggtggtgcag
ggcaccaagaaggagggctgtaccatcctcttcatgatgctctacttcttcagcatggcc
agttccatctggtgggtcatcttgtcgctcacctggttcctggcggccggcatgaagtgg
ggccacgaggccatcgaggccaactcgcagtactttcacctggccgcgtgggccgtgccc
gccgtcaagactatcacgatcctggctatgggccagatcgacggcgacctgctgagcggc
gtgtgcttcgtgggcctcaatagcctggacccgttgcggggcttcgtgctggcgccgctc
ttcgtgtacctgttcataggcacgtccttcctcctggccggcttcgtgtccctcttccgc
atccgtaccatcatgaaacacgacggtactaagacggagaagctggagcggctgatggtg
cgcatcggcgtcttctcggtgctctacacggtgcccgccaccatcgtcatcgcctgctac
ttctacgagcaggccttccgagagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccgtgcccggcgcactacacgccgcgcatgtctcccgacttcaccgtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggcttctggatctgg
tccggcaagacgctgcactcgtggaggaagttctacacccgtctcaccaacagccggcac
ggcgagaccaccgtgtga

KEGG   Bos indicus (zebu cattle): 109575114
Entry
109575114         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: frizzled-3-like
  KO
K02329  frizzled 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109575114
   04390 Hippo signaling pathway
    109575114
   04150 mTOR signaling pathway
    109575114
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109575114
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109575114
  09158 Development and regeneration
   04360 Axon guidance
    109575114
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109575114
   05206 MicroRNAs in cancer
    109575114
   05205 Proteoglycans in cancer
    109575114
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109575114
   05226 Gastric cancer
    109575114
   05217 Basal cell carcinoma
    109575114
   05224 Breast cancer
    109575114
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109575114
   05022 Pathways of neurodegeneration - multiple diseases
    109575114
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109575114
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109575114
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109575114
G protein-coupled receptors [BR:biu04030]
 Frizzled / Smoothened family
  109575114
SSDB
Motif
Pfam: Frizzled Fz FxsA
Other DBs
NCBI-GeneID: 109575114
NCBI-ProteinID: XP_019838730
UniProt: A0A6P5DND6
LinkDB
Position
21
AA seq 474 aa
MAMSWIICXLWPLTMFVGHIGRHSLFSXEPITLRMCQDLPYNTVFXPNLLNHYDQQXAVL
AMEPFRPVVNLDCSRGFRPSPCALCAPICVEYSRVTPPCHRFCQRAHSECLKLMELFGVA
WPEDMECSRFPDCGEPYPRLVDLNLAGDPXEGASVAVQRDYGFWCXXELKIDPDLGCCFL
HMRDCSPPCPNMYFRREELSFARYFIGLISVICLSATLFTFLTFLIDVIRFQYSERTVRI
YAVCYMMVLLIFFIGFLLEDRVACNSSSPAQYKASTVTQGSHNKTCIMLLMILYFFTMAG
SIWWVILTIXWFLAAVPKSGSEAIGKEALLFHASVWGVPGTLTIILLAMNKIEGDSISGV
CFVGLYDVDALRYFVLAPLCLYVVFGVSLLLAGIISLNRVRVEIPLZKVNQDKLVKFMIW
IGVFSTLYLVPLMVVIGCYFYEQAYRGIWETTWIQERCRAYHIPCPYKVRETLF
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggctatgagttggatcatctgcwatctgtggccyttgactatgtttgtgggccatata
ggtaggcacagtttgttttctnttgagcctattaccttgaggatgtgccaggatttgcct
tataacactgtcttcaygcccaatcttctgaatcactatgaccaacagayggcagtttta
gcaatggagccattccgcccwgtggtgaatttggactgctctcggggtttccggccatct
ccctgtgcactctgtgctcctatctgtgtggaatacagtcgtgtcacacctccctgccat
aggttctgtcagcgggctcacagtgagtgtttgaagctcatggagctgtttggtgttgct
tggcctgaagatatggaatgcagtaggttyccagattgtggtgagccgtatcctcggctg
gtggacctgaatttagctggcgatcctwctgaaggagcctcagtggcagtgcagagggac
tatggcttttggtgtcycyragagttgaaaattgatcctgatcttggctgttgctttttg
cacatgcgtgattgttcacctccttgtccaaatatgtactttaggagagaagagctttca
tttgctcggtatttcataggattgatttcagtcatttgcctctccgccacgttgtttact
tttttaacttttttgattgatgtgataagattccagtattctgaaagaaccgttagaatt
tatgcygtctgctacatgatggtgttattaattttctttattgggtttttgcttgaggac
cgagtcgcctgcaattcatccagccctgcacagtataaggcttccacagtcacccaagga
tctcataacaaaacctgtatcatgctccttatgatactctattttttcactatggctggc
agcatttggtgggtgattcttaccatcaygtggttcttggcagctgtgccaaagtcgggt
agtgaagctattgggaaggaagccttgctgttccatgccagtgtgtggggcgtccctgga
acgctgaccatcatccttttagcgatgaataaaattgaaggtgacagtatcagtggcgtg
tgttttgttggcctctatgatgttgatgcyttgaggtattttgttcttgcacccctctgc
ctgtatgtggtatttggggtttcactccttttagccggcattatatccctaaacagagtg
cgagttgagattccattasaaaaggtgaaccaggataaactggtgaagtttatgatctgg
attggtgttttcagcactctgtatctcgtaccactcatggttgtaattggatgctacttt
tatgagcaagcttaccgcggcatctgggaaacaacgtggatacaagaacgmtgcagagca
tatcacattccatgtccatataaggtcagggaaaccttgttctaa

KEGG   Bos indicus (zebu cattle): 109578168
Entry
109578168         CDS       T04792                                 

Gene name
FZD9
Definition
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109578168 (FZD9)
   04390 Hippo signaling pathway
    109578168 (FZD9)
   04150 mTOR signaling pathway
    109578168 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109578168 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109578168 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109578168 (FZD9)
   05205 Proteoglycans in cancer
    109578168 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109578168 (FZD9)
   05226 Gastric cancer
    109578168 (FZD9)
   05217 Basal cell carcinoma
    109578168 (FZD9)
   05224 Breast cancer
    109578168 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109578168 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    109578168 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109578168 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109578168 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109578168 (FZD9)
   04090 CD molecules [BR:biu04090]
    109578168 (FZD9)
G protein-coupled receptors [BR:biu04030]
 Frizzled / Smoothened family
  109578168 (FZD9)
CD molecules [BR:biu04090]
 Proteins
  109578168 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 109578168
NCBI-ProteinID: XP_019842726
UniProt: A0A6P5DWK4
LinkDB
Position
25
AA seq 793 aa
MAMVEAGTRAVGQEEAYQSQAGEGPGCAQWSAAPGEVSTNYNHCPGSMLHTAPAMYQAIK
QGQSGRNENRLRAKGPEPHATSEEAERLRSNCPRVHGRGVPGVEALEMVPPGEKPQLRGA
APLKPGRGSCRARKGPALGRVQQAPRPKACTRGPGRRRLLRLGGGSSSGGGGGGSASPFP
RAXSPRAAQGARPRRDTRGRLRYGPVVPPLRRALLLWQLLAAGGAALEIGRFDPERGRGP
APCQVVEIPMCRGIGYNLTRMPNLLGHTSQGEAXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXRLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAP
ENATAGPTEPHKGLGMLPVAPRPARPAEXXXQGAGGTCENPEKFQYVEKSRSCAPRCGPG
VEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYS
LAFLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTW
FLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVANMDAAAL
TGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVP
ATCVIVCYVYERLNMDFWRLRATEQACSAATTPGGRRDCSLQGGSVPTVAVFMLKIFMSL
VVGITSGVWVWSSKTFQTWQSLCHRKMAAGRAXXKACRAPGGYGRGTHGHYKAPTVVLHM
TKTDPSLENPTHL
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggctatggtggaggcaggcaccagggccgtagggcaggaggaggcatatcagagtcaa
gctggggaagggccagggtgtgcccagtggagcgctgctccaggggaggtgagcaccaat
tacaaccactgccccggctccatgctgcacaccgcccccgctatgtaccaggctatcaag
cagggccagtcgggcagaaacgaaaacaggctcagagcgaagggcccagagccacatgct
actagtgaagaggcggagaggctgcgctcgaactgccccagagtccacggtcgaggcgtc
ccaggagtagaagccttagaaatggtcccgcctggggaaaaaccgcagctgcgaggcgcg
gcgcctttaaagcccggtcgggggtcgtgtcgggcgcgcaaaggccccgcccttgggcgt
gtccagcaggcgccccgccccaaggcttgtacccgcggccccgggaggcggcgcctgctc
cggctcggcggcggttcgagtagcggcggcggcggcggtggctcggcgtctcctttccct
cgggcgrcttctccgcgcgctgcccagggcgcccggccgcgcagggacacacgcggccgg
ctccgctatggcccggtcgtgccgccgctccgccgggcgctgctgctgtggcagctgctg
gctgcgggcggcgcggcgctggagatcggccgcttcgacccggagcgcgggcgcgggccg
gcgccgtgccaggtggtggagatccccatgtgccgcggcatcggctacaacctgacccgt
atgcccaacctgctgggccacacgtcgcagggcgaggcgnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnngcgcctgcgctgcgcgcccatcatggagcagttcaacttcggctggccggactcg
ctggactgcgcccggctgcccacgcgcaacgacccgcacgcgctctgcatggaggcgccc
gagaacgccacggctggccccaccgagccccacaagggcctgggcatgctgcccgtggcg
ccgcggcccgcgcggcccgccgaggannnnnnccagggcgccggcggcacctgcgagaac
ccagagaagttccagtacgtrgagaagagccgctcgtgcgcgccgcgctgcgggccaggc
gtcgaggtgttctggtcgcggcgcgacaaggacttcgcgctcgtctggatggccgtgtgg
tcggcgctgtgcttcttctccaccgccttcaccgtgctcaccttcctgctggagccgcac
cgcttccagtacccggagcgtcccatcatcttcctctccatgtgctacaacgtctactcg
ctggccttcctcatccgggccgtggccggggcccagagcgtggcctgcgaccaggaggcg
ggtgcgctctacgtgatccaggagggcctggagaacacgggctgcaccctcgtcttcctg
ctgctctactacttcggtatggccagctcgctctggtgggtggtgctgaccctcacctgg
ttcctggccgccggcaagaaatggggccacgaggccatcgaggcccacggcagctacttc
cacatggcagcctggggcctgccagccctcaagaccattgttatcctgacgctgcgcaag
gtggcgggggatgagctgaccgggctctgttatgtggccaatatggacgcggcggcgctc
accggtttcgtgctggtgcccctctcctgctacctggtgctgggcacgagtttcctcctg
actggcttcgtggccctcttccacatccgcaagatcatgaagaccgggggcaccaacacg
gagaagctggagaagctcatggtcaagattggggtcttctccatcctttacaccgtgcct
gccacctgcgtcattgtgtgctacgtctacgaacgcctcaacatggacttctggcgcttg
cgggccacggaacaggcctgctccgcggccaccacgcccggcggccggagggactgctcg
ctgcaagggggctcggtgcccaccgtggctgtttttatgctcaaaatcttcatgtcgttg
gtggtgggcatcaccagcggcgtctgggtgtggagctccaagactttccagacctggcag
agcctgtgccaccgcaagatggcagctggccgggccnnnnnaaaggcctgccgggcccct
gggggctatggccggggcacccacggccactataaggcccccactgtggtcttgcacatg
actaagacagatccttctctggagaaccctacacacctctag

DBGET integrated database retrieval system