KEGG   Bos indicus (zebu cattle): 109554358
Entry
109554358         CDS       T04792                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04012  ErbB signaling pathway
biu04066  HIF-1 signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04350  TGF-beta signaling pathway
biu04371  Apelin signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04714  Thermogenesis
biu04910  Insulin signaling pathway
biu04931  Insulin resistance
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05221  Acute myeloid leukemia
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109554358 (RPS6KB2)
   04350 TGF-beta signaling pathway
    109554358 (RPS6KB2)
   04371 Apelin signaling pathway
    109554358 (RPS6KB2)
   04066 HIF-1 signaling pathway
    109554358 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    109554358 (RPS6KB2)
   04152 AMPK signaling pathway
    109554358 (RPS6KB2)
   04150 mTOR signaling pathway
    109554358 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109554358 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    109554358 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109554358 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    109554358 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    109554358 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    109554358 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109554358 (RPS6KB2)
   05205 Proteoglycans in cancer
    109554358 (RPS6KB2)
   05231 Choline metabolism in cancer
    109554358 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109554358 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109554358 (RPS6KB2)
   05212 Pancreatic cancer
    109554358 (RPS6KB2)
   05225 Hepatocellular carcinoma
    109554358 (RPS6KB2)
   05226 Gastric cancer
    109554358 (RPS6KB2)
   05221 Acute myeloid leukemia
    109554358 (RPS6KB2)
   05224 Breast cancer
    109554358 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109554358 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109554358 (RPS6KB2)
   05163 Human cytomegalovirus infection
    109554358 (RPS6KB2)
   05165 Human papillomavirus infection
    109554358 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109554358 (RPS6KB2)
   01522 Endocrine resistance
    109554358 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109554358 (RPS6KB2)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109554358 (RPS6KB2)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   109554358 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal FTA2 FeoB_C Kdo Seadorna_VP7
Other DBs
NCBI-GeneID: 109554358
NCBI-ProteinID: XP_019810341
UniProt: A0A6P5B0G4
LinkDB
Position
29
AA seq 485 aa
MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTESSVNPGPE
RIGPHCFELLRVLGKGNYGKVFQVRKVQGSNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLSEITL
ALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLELPPYLTPDARDLV
KKFLKRNPNQRIGGGPGDAADVQRHPFFRHVNWDDLLARRVDPPFRPSLQSEEDVSQFDS
HFTKQTPVDSPDDTTLSESANQAFLGFTYVAPSVLDSIKEAFSFQPKLRSPRRLNSSPRT
PVSPLKFSPFEGFRPSPGPQELVEPPLPPLLPPPPPPPPSSTAPLPIRPPSGTKKSKRGR
GRPGR
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggcggtgttygacctggacctggagacagaggaaggcagcgaaggcgagggcgag
ccagagctcagccccgcggacgcgtgtcccctcgcggagttgagggcggctggcctggag
cctgtgggacactatgaggaggtggagctgactgagagcagtgtgaacccgggccccgag
cgcatcggtccccactgctttgagctgctgcgtgtgctgggcaaggggaactatggcaag
gtgttccaggtgcgaaaggtacagggcagcaatctgggcaaaatatatgccatgaaagtc
ctgaggaaggccaaaattgtgcgcaaygccaaggacacggcacacacgcgggccgagcgg
aacattctggagtcggtgaagcaccccttcattgtggaactggcctatgccttccagact
ggcggcaaactgtacctcatcctcgagtgcctcagcggtggtgagcttttcacgcacctg
gagcgagaaggcatcttcctagaagacacggcctgtttctacctgtcggagatcacactg
gccctgggccatctccactcccaaggcatcatctaccgggacctcaaacctgaaaacatc
atgctcagcagccagggccacatcaaactgacggactttggcctctgcaaggagtcgatc
cacgagggcgccgtgacccacaccttctgcggcaccatcgagtacatggcccctgagatt
ctggtgcgcagtggccacaaccgggcggtggactggtggagcttgggggccctgatgtac
gacatgctcactggatcgccgcccttcactgcagagaaccggaagaaaaccatggacaag
atcatcagagggaagctggarctgcccccctacctcaccccggatgcccgggatcttgtc
aaaaagttcctgaagcggaatcctaaccagcggattggagggggccccggggatgctgct
gaygtgcagaggcaccccttcttccggcaygttaattgggatgacctcctggcccgccgt
gtggacccccctttccggccttccctgcagtcggaggaggacgtgagccagtttgactcc
cacttcacgaagcagacgccggtggacagtccagacgacacgacgctcagtgagagtgcc
aaccaggccttcctgggcttcacgtacgtggcgccctccgtcctggatagcatcaaggag
gccttctccttccagcccaagctgcgctcgcccaggcgcctcaacagcagcccccggacc
cctgtcagccccctgaagttctcgcccttcgaggggttccggcccagccctggcccacag
gagctcgtggagcccccactacctcctctgctgccaccgccgccaccaccaccgccctcg
agcactgcccctctccccatccgacccccctcggggaccaagaagtccaagaggggccgc
gggcgccctgggcgctaa

KEGG   Bos indicus (zebu cattle): 109573726
Entry
109573726         CDS       T04792                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04012  ErbB signaling pathway
biu04066  HIF-1 signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04350  TGF-beta signaling pathway
biu04371  Apelin signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04714  Thermogenesis
biu04910  Insulin signaling pathway
biu04931  Insulin resistance
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05221  Acute myeloid leukemia
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109573726 (RPS6KB1)
   04350 TGF-beta signaling pathway
    109573726 (RPS6KB1)
   04371 Apelin signaling pathway
    109573726 (RPS6KB1)
   04066 HIF-1 signaling pathway
    109573726 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    109573726 (RPS6KB1)
   04152 AMPK signaling pathway
    109573726 (RPS6KB1)
   04150 mTOR signaling pathway
    109573726 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109573726 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    109573726 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109573726 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    109573726 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    109573726 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    109573726 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109573726 (RPS6KB1)
   05205 Proteoglycans in cancer
    109573726 (RPS6KB1)
   05231 Choline metabolism in cancer
    109573726 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109573726 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109573726 (RPS6KB1)
   05212 Pancreatic cancer
    109573726 (RPS6KB1)
   05225 Hepatocellular carcinoma
    109573726 (RPS6KB1)
   05226 Gastric cancer
    109573726 (RPS6KB1)
   05221 Acute myeloid leukemia
    109573726 (RPS6KB1)
   05224 Breast cancer
    109573726 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109573726 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109573726 (RPS6KB1)
   05163 Human cytomegalovirus infection
    109573726 (RPS6KB1)
   05165 Human papillomavirus infection
    109573726 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109573726 (RPS6KB1)
   01522 Endocrine resistance
    109573726 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109573726 (RPS6KB1)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109573726 (RPS6KB1)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   109573726 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 109573726
NCBI-ProteinID: XP_019836670
UniProt: A0A6P5DGZ8
LinkDB
Position
19
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSALSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggtttctacccagcgccggacttccgagacagggaa
gctgaggacatggcaggggtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctccttcgagtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaataccgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcctttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagaaggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcacgtcaaactaacagattttggactatgc
aaagaatctattcatgacggaacagtcacacacaccttttgtggaacaatagaatacatg
gcccctgagatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacgcaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggtcct
ggggatgctggagaagttcaagctcatccattcttcagacatattaactgggaagaactg
ctggctcggaaggtggagccccccttcaaacctcttttgcaatcagaagaggatgtgagt
cagtttgattccaagtttacacgtcagacacctgttgacagcccagatgactcagctctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agcgtgaaagaaaagttttcctttgaaccaaaaatccgatcccctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacggcaaatccgcagacgcctgtggaataccccatggaaacaagtggg
atagagcagatggacgtgacgatgagcggggaggcttcagcaccgcttccaatacgacag
ccaaactccggaccgtacaaaaaacaagcttttcccatgatctccaaacgaccagagcac
ctgcgtatgaatctatga

DBGET integrated database retrieval system