KEGG   Bos indicus (zebu cattle): 109554414
Entry
109554414         CDS       T04792                                 

Gene name
PPP1CA
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-alpha catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03015  mRNA surveillance pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04114  Oocyte meiosis
biu04218  Cellular senescence
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04390  Hippo signaling pathway
biu04510  Focal adhesion
biu04611  Platelet activation
biu04720  Long-term potentiation
biu04728  Dopaminergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04921  Oxytocin signaling pathway
biu04931  Insulin resistance
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05168  Herpes simplex virus 1 infection
biu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    109554414 (PPP1CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109554414 (PPP1CA)
   04024 cAMP signaling pathway
    109554414 (PPP1CA)
   04022 cGMP-PKG signaling pathway
    109554414 (PPP1CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109554414 (PPP1CA)
   04218 Cellular senescence
    109554414 (PPP1CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109554414 (PPP1CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109554414 (PPP1CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109554414 (PPP1CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109554414 (PPP1CA)
   04921 Oxytocin signaling pathway
    109554414 (PPP1CA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109554414 (PPP1CA)
   04270 Vascular smooth muscle contraction
    109554414 (PPP1CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    109554414 (PPP1CA)
   04720 Long-term potentiation
    109554414 (PPP1CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109554414 (PPP1CA)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109554414 (PPP1CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    109554414 (PPP1CA)
   05034 Alcoholism
    109554414 (PPP1CA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109554414 (PPP1CA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109554414 (PPP1CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109554414 (PPP1CA)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:biu03021]
    109554414 (PPP1CA)
   03019 Messenger RNA biogenesis [BR:biu03019]
    109554414 (PPP1CA)
   03041 Spliceosome [BR:biu03041]
    109554414 (PPP1CA)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109554414 (PPP1CA)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     109554414 (PPP1CA)
Transcription machinery [BR:biu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     109554414 (PPP1CA)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     109554414 (PPP1CA)
Spliceosome [BR:biu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    109554414 (PPP1CA)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 109554414
NCBI-ProteinID: XP_019810439
UniProt: A0A6P5BK56
LinkDB
Position
29
AA seq 330 aa
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggactctataatcggacgcctgctggaagtgcag
ggctccaggcctggaaagaatgtacagctgacggagaacgagatccgtggtctgtgcctc
aaatcccgggagattttcctgagccagcccattcttctggagctggaggcacccctcaag
atctgcggtgacattcacggccagtactatgatcttctgcggctgttcgagtacggtggc
ttccctccagagagtaactacttgttcctgggggactacgtggacaggggcaagcagtct
ttggagaccatctgcctgctgctggcctataagatcaagtacccagagaacttcttcctg
ctccgtgggaaccacgagtgtgccagcatcaaccgcatctacggcttctatgatgagtgc
aagagacgctacaacatcaaactgtggaagaccttcactgattgcttcaactgcctgccc
atcgctgccatcgtggacgagaagatcttctgttgccatggagggctgtccccagaccta
cagtccatggagcagatccggcgtatcatgcggcccacagatgtgcctgaccagggcctg
ctctgtgacctgctgtggtctgaccctgacaaggacgtgcagggctggggygagaatgac
cgcggcgtctcctttacatttggagctgaggtggtggccaagttcctgcacaagcatgac
ctggacctcatctgccgggcacaccaggtagtagaagacggctatgagttctttgccaag
cggcagctggtgacactcttttcagcccccaactactgcggcgagtttgacaatgcaggt
gccatgatgagtgtggacgagacgctcatgtgctccttccagatcctcaagcccgctgac
aagaacaaggggaaatacgggcagttcagtggcctgaaccctggaggccggcccatcacc
ccaccccgcaactccgccaaagccaagaaatag

KEGG   Bos indicus (zebu cattle): 109566263
Entry
109566263         CDS       T04792                                 

Gene name
PPP1CB
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03015  mRNA surveillance pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04114  Oocyte meiosis
biu04218  Cellular senescence
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04390  Hippo signaling pathway
biu04510  Focal adhesion
biu04611  Platelet activation
biu04720  Long-term potentiation
biu04728  Dopaminergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04921  Oxytocin signaling pathway
biu04931  Insulin resistance
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05168  Herpes simplex virus 1 infection
biu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    109566263 (PPP1CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109566263 (PPP1CB)
   04024 cAMP signaling pathway
    109566263 (PPP1CB)
   04022 cGMP-PKG signaling pathway
    109566263 (PPP1CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109566263 (PPP1CB)
   04218 Cellular senescence
    109566263 (PPP1CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109566263 (PPP1CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109566263 (PPP1CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109566263 (PPP1CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109566263 (PPP1CB)
   04921 Oxytocin signaling pathway
    109566263 (PPP1CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109566263 (PPP1CB)
   04270 Vascular smooth muscle contraction
    109566263 (PPP1CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    109566263 (PPP1CB)
   04720 Long-term potentiation
    109566263 (PPP1CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109566263 (PPP1CB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109566263 (PPP1CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    109566263 (PPP1CB)
   05034 Alcoholism
    109566263 (PPP1CB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109566263 (PPP1CB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109566263 (PPP1CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109566263 (PPP1CB)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:biu03021]
    109566263 (PPP1CB)
   03019 Messenger RNA biogenesis [BR:biu03019]
    109566263 (PPP1CB)
   03041 Spliceosome [BR:biu03041]
    109566263 (PPP1CB)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109566263 (PPP1CB)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     109566263 (PPP1CB)
Transcription machinery [BR:biu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     109566263 (PPP1CB)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     109566263 (PPP1CB)
Spliceosome [BR:biu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    109566263 (PPP1CB)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 109566263
NCBI-ProteinID: XP_019826049
UniProt: A0A6P5CLF9
LinkDB
Position
11
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGXSFTFGADVVSKFLNXHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggacggagagctgaacgtggacagtcttattacccgactgctggaggtacgagga
tgtcgtccaggaaagattgtacagatgactgaagcagaagttcggggcttatgtatcaag
tctcgggagatctttctcagccagcctattcttttggaattggaagcaccactgaaaatc
tgtggagatattcatggacagtatacagatttactgcgattatttgaatatgggggtttc
cccccagaagccaactatcttttcttaggagattatgtggacagaggaaagcagtctttg
gaaacaatctgcttgctattggcttataaaatcaaatacccagaaaacttctttctctta
agaggaaaccatgagtgtgctagcatcaatcgcatttatggattctatgatgaatgcaaa
cgaagatttaatattaagttgtggaagaccttcactgattgtttcaactgtctgcctata
gctgccattgtggatgagaagatcttctgttgtcatggaggactgtcaccagacctgcaa
tctatggagcagatacggagaattatgagacccactgatgtccctgatacaggtttgctc
tgtgatttgctgtggtctgacccagataaggatgtgcaagggtggggagaaaatgatcgt
ggtgyttccttcacttttggagctgatgtagtcagtaaatttctgaatcstcatgattta
gacttgatttgtcgagctcatcaggttgtggaagatggatatgaattctttgctaagcga
caactggtaaccctgttttcagccccaaattactgtggcgagtttgataatgctggtgga
atgatgagtgtggatgaaactttgatgtgttcatttcagattttgaaaccatctgaaaag
aaagctaagtaccaatatggtggactgaattcaggacgtcctgtcactccacctcgaaca
gctaatccaccgaagaaaaggtga

KEGG   Bos indicus (zebu cattle): 109571193
Entry
109571193         CDS       T04792                                 

Gene name
PPP1CC
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03015  mRNA surveillance pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04114  Oocyte meiosis
biu04218  Cellular senescence
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04390  Hippo signaling pathway
biu04510  Focal adhesion
biu04611  Platelet activation
biu04720  Long-term potentiation
biu04728  Dopaminergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04921  Oxytocin signaling pathway
biu04931  Insulin resistance
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05168  Herpes simplex virus 1 infection
biu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    109571193 (PPP1CC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109571193 (PPP1CC)
   04024 cAMP signaling pathway
    109571193 (PPP1CC)
   04022 cGMP-PKG signaling pathway
    109571193 (PPP1CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109571193 (PPP1CC)
   04218 Cellular senescence
    109571193 (PPP1CC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109571193 (PPP1CC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109571193 (PPP1CC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109571193 (PPP1CC)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109571193 (PPP1CC)
   04921 Oxytocin signaling pathway
    109571193 (PPP1CC)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109571193 (PPP1CC)
   04270 Vascular smooth muscle contraction
    109571193 (PPP1CC)
  09156 Nervous system
   04728 Dopaminergic synapse
    109571193 (PPP1CC)
   04720 Long-term potentiation
    109571193 (PPP1CC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109571193 (PPP1CC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109571193 (PPP1CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    109571193 (PPP1CC)
   05034 Alcoholism
    109571193 (PPP1CC)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109571193 (PPP1CC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109571193 (PPP1CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109571193 (PPP1CC)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:biu03021]
    109571193 (PPP1CC)
   03019 Messenger RNA biogenesis [BR:biu03019]
    109571193 (PPP1CC)
   03041 Spliceosome [BR:biu03041]
    109571193 (PPP1CC)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109571193 (PPP1CC)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     109571193 (PPP1CC)
Transcription machinery [BR:biu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     109571193 (PPP1CC)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     109571193 (PPP1CC)
Spliceosome [BR:biu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    109571193 (PPP1CC)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 109571193
NCBI-ProteinID: XP_019833016
UniProt: A0A6P5D415
LinkDB
Position
17
AA seq 337 aa
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRVTSGLNPSIQKASNYRNNTVLYE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcggatatagataaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagcctggtaagaatgtccagctacaggagaatgaaatcagaggactgtgctta
aagtcccgagagatctttctcagtcagcctatcctgctagaacttgaagcaccactcaag
atatgtggtgatatccatgggcaatactatgatttgcttcgactttttgagtacggtggt
ttcccgccagaaagcaattacctgtttcttggggactatgtggacaggggaaaacaatca
ctggagactatctgcctcttgttggcttacaaaatcaaatatcccgagaatttttttctt
ctcagaggaaaccacgaatgtgccagcatcaatagaatttatggattttatgatgaatgt
aaaagaagatataacattaaactatggaaaactttcacagactgctttaactgtttaccg
atagcagccatcgtggatgagaaaatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatacgaattttttgcaaag
aggcagttggtcactctgttttctgcgcccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggacgaaacactaatgtgttcttttcagatattaaagcctgcagag
aaaaagaagcctaatgccacgagacccgtcacacctccaagggttacatcaggcctgaac
ccgtccattcagaaagcttcaaattatagaaacaatactgttctatacgagtga

DBGET integrated database retrieval system