KEGG   Bos indicus (zebu cattle): 109554418
Entry
109554418         CDS       T04792                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04261  Adrenergic signaling in cardiomyocytes
biu04668  TNF signaling pathway
biu04714  Thermogenesis
biu04725  Cholinergic synapse
biu04728  Dopaminergic synapse
biu04911  Insulin secretion
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04922  Glucagon signaling pathway
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04931  Insulin resistance
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04962  Vasopressin-regulated water reabsorption
biu05016  Huntington disease
biu05020  Prion disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109554418 (CREB3L4)
   04024 cAMP signaling pathway
    109554418 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    109554418 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    109554418 (CREB3L4)
   04152 AMPK signaling pathway
    109554418 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109554418 (CREB3L4)
   04922 Glucagon signaling pathway
    109554418 (CREB3L4)
   04915 Estrogen signaling pathway
    109554418 (CREB3L4)
   04926 Relaxin signaling pathway
    109554418 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    109554418 (CREB3L4)
   04918 Thyroid hormone synthesis
    109554418 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    109554418 (CREB3L4)
   04916 Melanogenesis
    109554418 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    109554418 (CREB3L4)
   04927 Cortisol synthesis and secretion
    109554418 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109554418 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109554418 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    109554418 (CREB3L4)
   04728 Dopaminergic synapse
    109554418 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    109554418 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    109554418 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109554418 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    109554418 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109554418 (CREB3L4)
   05020 Prion disease
    109554418 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    109554418 (CREB3L4)
   05031 Amphetamine addiction
    109554418 (CREB3L4)
   05034 Alcoholism
    109554418 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109554418 (CREB3L4)
   04934 Cushing syndrome
    109554418 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109554418 (CREB3L4)
   05161 Hepatitis B
    109554418 (CREB3L4)
   05163 Human cytomegalovirus infection
    109554418 (CREB3L4)
   05165 Human papillomavirus infection
    109554418 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109554418 (CREB3L4)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109554418 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB HAUS-augmin3 EMP24_GP25L
Other DBs
NCBI-GeneID: 109554418
NCBI-ProteinID: XP_019810452
UniProt: A0A6P5BCV0
LinkDB
Position
3
AA seq 496 aa
MDLDNPRLRDLPKSTRCLVIYSRPRFGVTWQVKPNLCPHSRNFPSPHPLPYCKSSGSYPP
SHAVEPNPCQTNKGPGCTGLFPPLSNSQFPPVTAEPASRRRTMDFKTPDLLDMCLEPPED
VFSTGSFLELGLQGLPSEVPVTRLQEQXLQGWECSVGHGCGLQESEPEDFLKLFIDPNQV
YCSEASPGSDSGISEDPGHPDSPPAPKPPSSPALYEVVYEAGTLERMQGEAGPAVGLISI
QLDQWSTPFTVPDACVVSELPPDAHILPTAATVNSAPPAALQLPCQTLFLTEEEKRLLGQ
EGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACAAQNQEL
QRKVQELERHNISLVTQLRQLQMLIVQTSNKAAQTSTCVLILLFSLALIILPSFSPFQGL
PEAGPEDYQPHGVISRNILTHRDMTENPENAVEESRLEGPPGAKGANSSTRTPLEKVGGM
AGPSRHIRTVLHADEM
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggatttggacaacccacgattacgcgacctcccaaagtcaacgcgctgtctggttatt
tactcccggcctagattcggagtcacgtggcaagtgaaaccaaacctctgcccacattcc
cggaacttcccctcaccccacccccttccctactgtaagtcktcyggctcttaccctcct
tctcacgctgtggaaccaaatccctgccagacaaataaaggccctggctgcactggcctc
tttccccccctctctaacagccaattcccaccagttacggcggagcctgcctccagacgc
agaaccatggatttcaaaacccctgacctgctggacatgtgtctggaacctccagaagat
gtcttctcaacaggatctttcctggagctgggactccaaggtctaccttcagaggttcca
gtgactaggctacaggaacaarggctgcaaggctgggagtgcagtgtgggccacggctgt
ggtcttcaagagagtgagcctgaagatttcctgaaacttttcattgaccccaatcaagtt
tactgctcagaagcatctcctggcagtgacagtggaatctctgaggatcccggccatcca
gacagtccccctgcccccaagccacccagttcccctgccctctatgaggttgtctatgag
gcagggaccctggagaggatgcagggggaagccgggccagctgtagggctcatctccatc
cagctagatcagtggagcacgccatttacagtgcctgatgcctgcgtggtcagtgagctg
cctcctgatgctcacatcctgcccacagcagctactgtaaactcagcgcctcccgcagcc
ctgcagctgccctgtcaaaccttgttcctgacagaagaggagaagcggctgctgggacag
gaaggggtttccctaccctctcacctgcccctcaccaaggcagaggagagggttctcaag
aaggtcagaaggaaaatccgtaataagcagtcagctcaggatagccggcggcggaaaaag
gagtacattgatggcctagagagcagggtggctgcctgtgctgcacagaaccaggaacta
cagagaaaagtccaggagctagagaggcacaacatctccctggtgactcagctccgccag
ctgcagatgcttattgttcaaacctccaacaaagctgcccagactagcacttgtgttctg
atccttcttttctccttggctctcatcatcttgcccagcttcagcccctttcagggcctg
ccagaagctgggcctgaggattaccagcctcatggagtgatttccagaaacatcctgact
cacagggacatgacagagaatcctgaaaacgcagtggaagagtccagactggagggacca
cctggggccaagggtgcaaacagctccacaaggacaccgcttgagaaggtgggagggatg
gcaggccccagcaggcacatcagaactgtgttacatgcagacgaaatgtga

KEGG   Bos indicus (zebu cattle): 109557489
Entry
109557489         CDS       T04792                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X1
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04261  Adrenergic signaling in cardiomyocytes
biu04668  TNF signaling pathway
biu04714  Thermogenesis
biu04725  Cholinergic synapse
biu04728  Dopaminergic synapse
biu04911  Insulin secretion
biu04915  Estrogen signaling pathway
biu04918  Thyroid hormone synthesis
biu04922  Glucagon signaling pathway
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04931  Insulin resistance
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04962  Vasopressin-regulated water reabsorption
biu05016  Huntington disease
biu05020  Prion disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109557489 (CREB5)
   04024 cAMP signaling pathway
    109557489 (CREB5)
   04022 cGMP-PKG signaling pathway
    109557489 (CREB5)
   04151 PI3K-Akt signaling pathway
    109557489 (CREB5)
   04152 AMPK signaling pathway
    109557489 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109557489 (CREB5)
   04922 Glucagon signaling pathway
    109557489 (CREB5)
   04915 Estrogen signaling pathway
    109557489 (CREB5)
   04926 Relaxin signaling pathway
    109557489 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    109557489 (CREB5)
   04918 Thyroid hormone synthesis
    109557489 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    109557489 (CREB5)
   04925 Aldosterone synthesis and secretion
    109557489 (CREB5)
   04927 Cortisol synthesis and secretion
    109557489 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109557489 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109557489 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    109557489 (CREB5)
   04728 Dopaminergic synapse
    109557489 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    109557489 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    109557489 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109557489 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    109557489 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109557489 (CREB5)
   05020 Prion disease
    109557489 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    109557489 (CREB5)
   05031 Amphetamine addiction
    109557489 (CREB5)
   05034 Alcoholism
    109557489 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109557489 (CREB5)
   04934 Cushing syndrome
    109557489 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109557489 (CREB5)
   05161 Hepatitis B
    109557489 (CREB5)
   05163 Human cytomegalovirus infection
    109557489 (CREB5)
   05165 Human papillomavirus infection
    109557489 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109557489 (CREB5)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    109557489 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri Cnn_1N NDUFB11 DivIC
Other DBs
NCBI-GeneID: 109557489
NCBI-ProteinID: XP_019814393
UniProt: A0A6P5B7I4
LinkDB
Position
4
AA seq 502 aa
MNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLK
NCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNPVGGAMAGPGAHQLGSARMPNHDT
SVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPT
MPGSSAVLMPMERQMSVNSNLLGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAM
SNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPAHHPYPHQHQHPAHHPHPQPHH
QQNHPHHHSHSHLHAHPAHHQTSPHPPLHSGTQAQQVSPATQQMQPTQTIQPPQPTGGRR
RRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKN
EVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPTPACSQQQVIQHNTITTSSAVS
EVVGSSTLSQLTTHRTDLNPIL
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgaatttggagcaggagaggccgtttgtctgcagtgccccaggctgctcccagcgcttc
ccaacagaggatcatctgatgattcataggcacaagcatgaaatgactttgaagtttccc
tcaataaaaacagacaatatgttatcagatcaaactccaaccccaacgagattcctgaag
aactgcgaggaggtggggctcttcagtgagttggactgctccctagagcatgagttcagg
aaggctcaggaggaagagagcagcaagcggaatatctcgatgcataaccccgttggtggg
gccatggcggggcctggagctcaccagctcggcagcgcccggatgcccaaccatgacacc
agcgttgtgattcagcaagccatgccgtcaccccagtccagctctgtcatcacgcaggcc
ccttccaccaaccgccagatcgggcctgtcccaggctctctatcttctctgctccatctt
cacaacagacagagacagcccatgccagcctccatgcctgggaccctgcccaaccctaca
atgccgggctcttctgccgtcttgatgccaatggagagacaaatgtcagtgaactccaac
ctcctgggaatgcaaggtccaaatctcagcaacccctgtgcttctccccaagtccagcca
atgcattcagaagctaagatgaggctgaaggctgcattgactcaccaccctgctgccatg
tcgaatgggaatatgaacaccatgggccacatgatggaaatgatgggctcccggcaggac
cagacgccacaccatcacatgcactcacacccgcatcagcaccagacactgccggcccac
cacccctacccgcaccagcaccagcacccagcacaccaccctcatcctcaaccccatcac
cagcagaaccacccacatcatcactcccactcccaccttcatgcacacccagcacatcac
cagacctcgccacacccacccctgcactccggcacccaagcacagcaggtttcaccagca
acacaacagatgcagcccacccagacaatacagccgccccagcccacaggggggcgccgg
cgaagggtggtggatgaggatcctgacgagaggcggcggaaatttctggaacggaaccgg
gcggccgccacccgctgcagacagaagaggaaggtctgggtgatgtcactggaaaagaaa
gcagaagagctcacccagacaaacatgcagcttcagaacgaagtgtccatgttgaagaac
gaggtggcacagctgaagcagctgttgttaacacataaagactgccccataacagccatg
cagaaagaatcacaaggatatctcagtccagagagtagccctcctgcaagtcccaccccc
gcatgctcgcagcagcaggtcatccagcataacaccatcaccacttcctcggcagtcagc
gaggtggtaggaagctctaccctcagccagctcaccactcacagaacagacctgaacccc
atcctctaa

KEGG   Bos indicus (zebu cattle): 109557676
Entry
109557676         CDS       T04792                                 

Gene name
CREB3L2
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-responsive element-binding protein 3-like protein 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04261  Adrenergic signaling in cardiomyocytes
biu04668  TNF signaling pathway
biu04714  Thermogenesis
biu04725  Cholinergic synapse
biu04728  Dopaminergic synapse
biu04911  Insulin secretion
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04922  Glucagon signaling pathway
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04931  Insulin resistance
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04962  Vasopressin-regulated water reabsorption
biu05016  Huntington disease
biu05020  Prion disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109557676 (CREB3L2)
   04024 cAMP signaling pathway
    109557676 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    109557676 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    109557676 (CREB3L2)
   04152 AMPK signaling pathway
    109557676 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109557676 (CREB3L2)
   04922 Glucagon signaling pathway
    109557676 (CREB3L2)
   04915 Estrogen signaling pathway
    109557676 (CREB3L2)
   04926 Relaxin signaling pathway
    109557676 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    109557676 (CREB3L2)
   04918 Thyroid hormone synthesis
    109557676 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    109557676 (CREB3L2)
   04916 Melanogenesis
    109557676 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    109557676 (CREB3L2)
   04927 Cortisol synthesis and secretion
    109557676 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109557676 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109557676 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    109557676 (CREB3L2)
   04728 Dopaminergic synapse
    109557676 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    109557676 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    109557676 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109557676 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    109557676 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109557676 (CREB3L2)
   05020 Prion disease
    109557676 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    109557676 (CREB3L2)
   05031 Amphetamine addiction
    109557676 (CREB3L2)
   05034 Alcoholism
    109557676 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109557676 (CREB3L2)
   04934 Cushing syndrome
    109557676 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109557676 (CREB3L2)
   05161 Hepatitis B
    109557676 (CREB3L2)
   05163 Human cytomegalovirus infection
    109557676 (CREB3L2)
   05165 Human papillomavirus infection
    109557676 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109557676 (CREB3L2)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109557676 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY
Other DBs
NCBI-GeneID: 109557676
NCBI-ProteinID: XP_019814712
UniProt: A0A6P5BKS0
LinkDB
Position
4
AA seq 520 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHITASDSFNDDEVESEKWYLSPDF
PPTTIKTEPITDEPPSGLVPSVTLTITAISTPXEKEETPLEMNAGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEASVDHLHLPPTPPSSNSSDSEGSLSPSPRLHPFGLPQTHSPARAPA
RAPSALASSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT
SSVVRSRNLLIYEEHSPLEEPPSSASAGELGRWDRGSALLRAKGLESRPDVDLPHFIISN
ETSLEKSVLLELQQHMVSTNLEGNETLKVVELDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcartgggaccgcaagctgagcgag
ctgtcagagcccggggagaccgaggctctcatgtaccacacgcacttctcggagcttctg
gatgagttttcccagaatgtcttgggccagctcctcaacgaccctttcctctcagagaag
agcgtgtcgatggaggtggagccatccccgacgtccccggcacccctcatccaggccgag
cacagctactccctatgtgaggagcctcgggcccagtcgccattcacccacatcacggcc
agcgacagcttcaatgacgatgaagtggagagtgagaaatggtacctgtctccagacttt
ccaccaacaaccatcaagacagagcccatcacggacgagccaccctcaggactcgtcccc
tctgtcacgctgaccatcactgcaatctccaccccgnttgaaaaggaggaaacccctctg
gaaatgaacgctggggttgattcctcatgccagaccattattcctaagattaagctggag
cctcatgaagtggatcagttcctaaacttctctcccaaggaagcctccgtggaccacctg
cacttaccgcccactcctcccagcagcaacagcagcgactccgagggcagcctgagcccc
agcccgcgcctgcacccctttggccttccgcagacccacagccccgccagggccccagcg
cgggccccctcggcgctggccagctccccgctcctcactgctcctcataagctgcaggga
tcaggccccctggtcctgacggaggaggagaagaggaccctgatcgccgagggctatccc
atccccaccaagttgcccctgacaaaatcagaggagaaggccctaaagaaaatccggagg
aaaatcaagaataagatttcagcccaggaaagtaggaggaagaagaaagaatacatggac
agcttggagaaaaaggtagagtcttgttcaacggagaacttggagcttcggaagaaggtg
gaggttctggagaacaccaacagaactctcctgcagcagctgcagaagcttcagactttg
gtgatgggcaaggtttctcgcacctgcaagctggccggcacgcagactggcacatgcctt
atggtcgtggtgctgtgctttgccgtagcatttggcagcttctttcagggctatgggccc
tatccttctgccaccaagatggccctgcccagccagcattccctgcaggaaccctacaca
tcctctgtggtgagatccaggaacctgctgatctatgaggaacattctcccctggaggag
ccacccagttccgcctcagctggggagctgggacgctgggaccgaggctctgctctgctc
agggcaaaagggctggagtccaggccggacgtggatcttccccatttcattatctcaaat
gagaccagcctggagaaatcagtgctgttggagctgcagcagcacatggtcagcaccaac
ctggaggggaatgagacactaaaagtcgtagaactcgacagaagagtgaacgccaccttt
taa

KEGG   Bos indicus (zebu cattle): 109559832
Entry
109559832         CDS       T04792                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04137  Mitophagy - animal
biu04141  Protein processing in endoplasmic reticulum
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04261  Adrenergic signaling in cardiomyocytes
biu04668  TNF signaling pathway
biu04720  Long-term potentiation
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04728  Dopaminergic synapse
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04915  Estrogen signaling pathway
biu04918  Thyroid hormone synthesis
biu04922  Glucagon signaling pathway
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04932  Non-alcoholic fatty liver disease
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109559832 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109559832 (ATF4)
   04668 TNF signaling pathway
    109559832 (ATF4)
   04022 cGMP-PKG signaling pathway
    109559832 (ATF4)
   04151 PI3K-Akt signaling pathway
    109559832 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109559832 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    109559832 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109559832 (ATF4)
   04922 Glucagon signaling pathway
    109559832 (ATF4)
   04912 GnRH signaling pathway
    109559832 (ATF4)
   04915 Estrogen signaling pathway
    109559832 (ATF4)
   04926 Relaxin signaling pathway
    109559832 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    109559832 (ATF4)
   04918 Thyroid hormone synthesis
    109559832 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    109559832 (ATF4)
   04925 Aldosterone synthesis and secretion
    109559832 (ATF4)
   04927 Cortisol synthesis and secretion
    109559832 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109559832 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    109559832 (ATF4)
   04728 Dopaminergic synapse
    109559832 (ATF4)
   04720 Long-term potentiation
    109559832 (ATF4)
   04722 Neurotrophin signaling pathway
    109559832 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    109559832 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109559832 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    109559832 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109559832 (ATF4)
   05012 Parkinson disease
    109559832 (ATF4)
   05014 Amyotrophic lateral sclerosis
    109559832 (ATF4)
   05020 Prion disease
    109559832 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    109559832 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    109559832 (ATF4)
   05031 Amphetamine addiction
    109559832 (ATF4)
   05034 Alcoholism
    109559832 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109559832 (ATF4)
   04934 Cushing syndrome
    109559832 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109559832 (ATF4)
   05161 Hepatitis B
    109559832 (ATF4)
   05163 Human cytomegalovirus infection
    109559832 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109559832 (ATF4)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    109559832 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 DUF4407 Fez1 AAA_13 Nop53 bZIP_Maf DUF4795
Other DBs
NCBI-GeneID: 109559832
NCBI-ProteinID: XP_019817396
UniProt: A0A385KKP9
LinkDB
Position
5
AA seq 348 aa
MAEMSFLSSEVLGGDFVSPFDQLGLGAEESLGLLDDNLEVAKHFKHHGFSCDKAKAGSSE
WLAVDWLVSDNSKEDAFSGTDWMVEKMDLKEFDFDILFSKDDLETMPDELLATLDDTCDL
FQPLVQETNKEPPQIVNPIGHLPEGLPTIDQGAPFTFFQPLPPSPGTLSSTPDHSFSLEL
CSEVVIPEGDSKPDSTTTGFPQCIKEEDAPSDNDSGICMSPDSSLGSPQDSPSTSRGSPN
KSLLSPGALSGSSRPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQ
EALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKAREKKRVL
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggccgagatgagctttctgagcagcgaggtgttagggggggacttcgtgtcccccttc
gaccagttgggtttgggggctgaagagagcctaggtctcctagatgacaacctggaggtg
gccaagcacttcaaacatcatgggttctcctgcgacaaggctaaggcaggctcctccgaa
tggctggctgtggattggttggtctcagacaacagcaaggaggatgctttctccgggaca
gattggatggtggagaaaatggatttgaaggagtttgattttgatatcctgttcagtaaa
gatgacctggaaaccatgccagatgagctcttggccacgttggatgacacgtgtgatctc
tttcagcccctagtccaggagactaacaaggagcccccccagatagtaaacccaattggc
catcttccagaaggtttaccaacaattgaccagggtgcccccttcactttctttcaacct
cttcccccttccccagggaccctgtcttccactccagatcattcctttagtttagagcta
tgcagtgaagtggttatccctgaaggagatagcaagccagactccaccactactgggttt
cctcaatgcataaaagaggaggatgccccctcagataatgatagtggcatctgtatgagc
cctgactcctctctgggctctccccaggatagcccttccacctccaggggctctccaaat
aagagcctgctatctccaggtgccctcagtggctcttcccgccccaaaccctacgaccct
cctggagagaagatggtagcagcaaaagtcaagggtgagaagctagacaagaagctgaag
aaaatggagcagaacaagacagcagctactaggtaccgccagaagaagagggcggaacag
gaggccctcactggtgaatgtaaagagctagaaaaaaagaatgaggctctgaaagagaag
gcagattccttggccaaggagatccagtatcttaaagatctgatagaagaggttcgcaaa
gcaagggagaagaaaagggtcctctag

KEGG   Bos indicus (zebu cattle): 109561750
Entry
109561750         CDS       T04792                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04261  Adrenergic signaling in cardiomyocytes
biu04668  TNF signaling pathway
biu04714  Thermogenesis
biu04725  Cholinergic synapse
biu04728  Dopaminergic synapse
biu04911  Insulin secretion
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04922  Glucagon signaling pathway
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04931  Insulin resistance
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04962  Vasopressin-regulated water reabsorption
biu05016  Huntington disease
biu05020  Prion disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109561750 (CREB3L3)
   04024 cAMP signaling pathway
    109561750 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    109561750 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    109561750 (CREB3L3)
   04152 AMPK signaling pathway
    109561750 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109561750 (CREB3L3)
   04922 Glucagon signaling pathway
    109561750 (CREB3L3)
   04915 Estrogen signaling pathway
    109561750 (CREB3L3)
   04926 Relaxin signaling pathway
    109561750 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    109561750 (CREB3L3)
   04918 Thyroid hormone synthesis
    109561750 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    109561750 (CREB3L3)
   04916 Melanogenesis
    109561750 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    109561750 (CREB3L3)
   04927 Cortisol synthesis and secretion
    109561750 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109561750 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109561750 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    109561750 (CREB3L3)
   04728 Dopaminergic synapse
    109561750 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    109561750 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    109561750 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109561750 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    109561750 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109561750 (CREB3L3)
   05020 Prion disease
    109561750 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    109561750 (CREB3L3)
   05031 Amphetamine addiction
    109561750 (CREB3L3)
   05034 Alcoholism
    109561750 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109561750 (CREB3L3)
   04934 Cushing syndrome
    109561750 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109561750 (CREB3L3)
   05161 Hepatitis B
    109561750 (CREB3L3)
   05163 Human cytomegalovirus infection
    109561750 (CREB3L3)
   05165 Human papillomavirus infection
    109561750 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109561750 (CREB3L3)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109561750 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf pEK499_p136 ADIP DUF1664 ZapB
Other DBs
NCBI-GeneID: 109561750
NCBI-ProteinID: XP_019820008
UniProt: A0A6P5C3D1
LinkDB
Position
7
AA seq 499 aa
MDGDLAIGKMASSTSPMGPIDSLELLDLLFDRQDGVLRHVELGEDWGHGEDQVLPGADSD
DFLNSILGSGDSDSPTWSPAASDSGISEDLPSDTQDTPPHGGVPATPAGCHSVESGKGPC
PSYHPGPTCPARHLGPVAPRLETSVAIDLEMWSPGVYAEEQTDLADSPSRYNLTVKDLLL
SSSSGDXQQHHLAAPHLLRPGTGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYEERMLK
KIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKK
LQAIVVQSTSKSAQTGTCIAVLLFSFALIVLPSISPFASNRAESPGDFAPVRVFSRTLHN
DAASRVAPDTAPGSEAPGPGPNTGALQERSPGSPPGEWESQDTRALDNSTEDLDNSTLVQ
GNSVKELDQATLLDCAPPEPAVSPGHVGLEAAGGGAVNTMGPCPLLHPGPSAQGCFNRCC
SGQGQAWGSKVRERTWRRY
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggatggggacttagctattggaaagatggcttcctccaccagtcccatgggccctatc
gacagcctggaactcctggatctactgtttgaccggcaggacggcgtcctgagacacgta
gagctgggagaggactggggccatggggaggaccaggtcctgccaggtgcggactctgat
gacttcctcaactccatcctgggttctggagattcagattccccaacctggtcccccgcg
gccagtgacagtggcatctcagaagatctgccctctgacacccaggacacrcctccacac
ggtggggtgcctgccacccctgccggctgccatagtgtggagtctggcaaggggccctgc
ccctcctaccatcctggccccacctgccctgccaggcacctcgggccagtggccccaagg
cttgagacttctgttgccatagacctggaaatgtggagcccaggcgtctatgctgaggag
cagaccgacctggctgactcgccctcacgctacaacctcacagtcaaggacctcctcctc
tccagcagcagcggggaccygcagcaacatcacctggcagccccccacctgttgcgacct
gggactgggcactgccaggagctggtgctgacggaggatgagaagaagctactagccaaa
gaaggcatcactctgcccactcagctgccccttaccaagtatgaggagcgaatgctgaaa
aagatccgccggaaaatccgaaacaaacagtcagctcaagaaagccggaaaaagaagaag
gaatacattgatggcctggagactcggatgtcagcttgtaccgcccagaatcaggaactt
cagaggaaggtcttgcatctcgaaaagcagaacctgtctctcttggaacagctgaagaaa
ctccaggccattgtggtccagtctaccagcaaatcggcacagacgggcacttgcatagca
gtcctgctcttctccttcgccctcatcgtcctcccctccatcagccctttcgcctccaac
agagccgagagccccggagacttcgcacctgtgcgagttttctccagaactctacacaac
gacgcggcatcccgggtggctcccgacactgcaccaggctccgaggcccccggacccggg
cccaacactggtgcacttcaggaaaggtctccaggcagccctccgggggaatgggaatcc
caggacacacgtgctctggacaactcgacagaggatctggacaactcaactctggtccag
ggcaactctgtgaaggaactggaccaggccaccctactggactgtgccccacctgagcca
gcagtcagcccgggccacgtggggctggaggcagcaggggggggagctgtgaacaccatg
ggtccctgcccccttctccaccctggcccctctgctcaggggtgcttcaataggtgctgt
agtggacagggacaggcatggggatccaaggtgagagagagaacctggagaaggtattag

KEGG   Bos indicus (zebu cattle): 109563018
Entry
109563018         CDS       T04792                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04261  Adrenergic signaling in cardiomyocytes
biu04668  TNF signaling pathway
biu04714  Thermogenesis
biu04725  Cholinergic synapse
biu04728  Dopaminergic synapse
biu04911  Insulin secretion
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04922  Glucagon signaling pathway
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04931  Insulin resistance
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04962  Vasopressin-regulated water reabsorption
biu05016  Huntington disease
biu05020  Prion disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109563018 (CREB3)
   04024 cAMP signaling pathway
    109563018 (CREB3)
   04022 cGMP-PKG signaling pathway
    109563018 (CREB3)
   04151 PI3K-Akt signaling pathway
    109563018 (CREB3)
   04152 AMPK signaling pathway
    109563018 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109563018 (CREB3)
   04922 Glucagon signaling pathway
    109563018 (CREB3)
   04915 Estrogen signaling pathway
    109563018 (CREB3)
   04926 Relaxin signaling pathway
    109563018 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    109563018 (CREB3)
   04918 Thyroid hormone synthesis
    109563018 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    109563018 (CREB3)
   04916 Melanogenesis
    109563018 (CREB3)
   04925 Aldosterone synthesis and secretion
    109563018 (CREB3)
   04927 Cortisol synthesis and secretion
    109563018 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109563018 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109563018 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    109563018 (CREB3)
   04728 Dopaminergic synapse
    109563018 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    109563018 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    109563018 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109563018 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    109563018 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109563018 (CREB3)
   05020 Prion disease
    109563018 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    109563018 (CREB3)
   05031 Amphetamine addiction
    109563018 (CREB3)
   05034 Alcoholism
    109563018 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109563018 (CREB3)
   04934 Cushing syndrome
    109563018 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109563018 (CREB3)
   05161 Hepatitis B
    109563018 (CREB3)
   05163 Human cytomegalovirus infection
    109563018 (CREB3)
   05165 Human papillomavirus infection
    109563018 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109563018 (CREB3)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109563018 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 109563018
NCBI-ProteinID: XP_019821729
UniProt: A0A6P5C863
LinkDB
Position
8
AA seq 393 aa
MSHMELALDPGDHDLLGFLLEESGGLGAAPDEALTSPPDWELPLSESLSDWDVEDFLSCL
PSPPAVLNVFSNSDPCLVQHDHTYSLSQEHVSIDLGKPEISEVWERRGLQGLTIHICPFA
DNESYEKERAQMTPLRVEEPADQEIARLILTEEEKRLLEKEGLTLPGMLPLTKMEEQVLK
RVRRKIRNKKSAQESRRKKKVYVGGLESRVLKYTAQNLELQNKVQLLEEQNLSLLDQLRR
LQAMVIQTANKASSSSTCVLVLLFSFCLLLVPAMYSSDTRGSLPAEHRVLSRQLRALPSE
DPPQLEPPALQSEVPKDSLNPELQAASNSCCLFHLMPQAPRAEPPLQLPLPDGFSGCSCP
DSISPLHANLTREEGWLPTPSPTSVILQGRYSG
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgtctcatatggagctggcgttggacccgggtgaccacgacctgctaggctttctgcta
gaagaaagcggtggtttgggtgcggcgcccgacgaggccttgacgtctccgccggattgg
gagctgccactttctgagtctctgagcgactgggacgtggaggatttcctgagctgcctg
ccgagtcccccagcagtgttgaacgttttcagcaactctgacccctgtcttgtccagcat
gaccacacctattctctgtcacaagagcatgtctccatagatctcggtaagcctgaaata
agtgaagtttgggaaaggagaggactccagggcctgactattcatatttgcccttttgca
gataatgagagctatgaaaaagagagggctcagatgactccactgcgtgtggaggagccg
gcagatcaggagattgctaggctgatactgactgaggaggagaaaaggctgttggagaag
gaggggcttactttgcctgggatgcttccgctcactaagatggaggaacaagttctgaaa
cgggtgcggaggaagattcgaaacaaaaagtctgctcaagagagccgcaggaagaagaag
gtgtatgtggggggtttagaaagcagggtcctgaaatacacagcccagaatctggagcta
cagaacaaagtacagctcctggaggaacagaatctgtcccttttggatcagctgaggaga
ctccaggccatggtgattcagacagcaaacaaagccagcagcagcagcacctgtgtcttg
gttctactgttctccttctgtctcctcctcgtacctgctatgtactcctcggacacaagg
gggagcctgccggctgagcacagagtgttgtcccgtcagcttcgtgccctccccagcgag
gaccccccgcagctggagccacctgccctgcagtcagaggtaccaaaggacagcttgaac
cctgagctccaggctgctagcaactcttgctgcctcttccatctcatgccccaggctcct
agagcagagcctcccctgcaattgccactgcctgatggtttctcagggtgctcctgccca
gattccatatctcccctgcatgcaaatctcacaagagaggaaggatggctccctactccc
agccccacatctgttatcttgcagggcagatactcaggctag

KEGG   Bos indicus (zebu cattle): 109566270
Entry
109566270         CDS       T04792                                 

Gene name
ATF2
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04211  Longevity regulating pathway
biu04261  Adrenergic signaling in cardiomyocytes
biu04668  TNF signaling pathway
biu04714  Thermogenesis
biu04728  Dopaminergic synapse
biu04911  Insulin secretion
biu04915  Estrogen signaling pathway
biu04918  Thyroid hormone synthesis
biu04922  Glucagon signaling pathway
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu05020  Prion disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109566270 (ATF2)
   04668 TNF signaling pathway
    109566270 (ATF2)
   04022 cGMP-PKG signaling pathway
    109566270 (ATF2)
   04151 PI3K-Akt signaling pathway
    109566270 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109566270 (ATF2)
   04922 Glucagon signaling pathway
    109566270 (ATF2)
   04915 Estrogen signaling pathway
    109566270 (ATF2)
   04926 Relaxin signaling pathway
    109566270 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    109566270 (ATF2)
   04918 Thyroid hormone synthesis
    109566270 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    109566270 (ATF2)
   04925 Aldosterone synthesis and secretion
    109566270 (ATF2)
   04927 Cortisol synthesis and secretion
    109566270 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109566270 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    109566270 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    109566270 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    109566270 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109566270 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    109566270 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    109566270 (ATF2)
   05031 Amphetamine addiction
    109566270 (ATF2)
   05034 Alcoholism
    109566270 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109566270 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109566270 (ATF2)
   05161 Hepatitis B
    109566270 (ATF2)
   05163 Human cytomegalovirus infection
    109566270 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109566270 (ATF2)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    109566270 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 109566270
NCBI-ProteinID: XP_019826061
UniProt: A0A6P5CJ41
LinkDB
Position
2
AA seq 506 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHSS
GLVRTQSEESDPQSLQQPATSTTETPASPAHTTPQTQNTTGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPVLSQIVMAPSSQHSPQEVD
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacatgtaaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccgtttctatgtactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgagaatgagttcaagaaagcctca
gaagatgacattaaaaaaatgcctctagatttatctcctcttgcaacacccatcataaga
agcaaaattgaggagccttctgttgtagaaacaactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgagaaggaagtaccattggcacaaactgcacagcccaca
tcagctattgttcgtccagcatctttacaagttcccaatgtgctgcttacaagttctgac
tcaagtgtcattattcagcaggcagtaccttcaccaacctcaagtactgtaatcacccag
gcaccgtcctccaacaggccaattgttcctgtaccaggcccatttcctcttctgttacat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaatcacaagttctaatgtg
catgttccagctgcagttccacttgttcgaccagtcaccatggtgcctagcgttccagga
attccaggtccttcctctcctcaaccagtgcagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaacggcgatactgtcaaaggtcacagtagt
ggtttggttaggactcaatcagaggaatctgacccacagtcattacaacagccagccaca
tccaccacagaaacaccggcttctccagctcacacaactccacagacccaaaatacaact
ggtcgtcgaagaagagcagctaatgaagatcccgatgaaaaaaggaggaagtttctggaa
agaaatagagcagcagcttcaagatgccgacaaaagagaaaagtctgggttcagtcttta
gagaagaaagcagaagacttgagttcattaaatggtcaactgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactgctgataaagacgatagttcagaagat
ttgtcagtgccgagtagtccacataccgaagctatacaacatagttctgtcagcacatcc
aatggagtcagttcaacttccaaggcagaagctgtagccacttcagtcctcacccagatg
gcggaccagagtacagagcctgtgctttcgcagattgtcatggctccttcctcccagcac
agccctcaggaagttgattaa

KEGG   Bos indicus (zebu cattle): 109569868
Entry
109569868         CDS       T04792                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04261  Adrenergic signaling in cardiomyocytes
biu04668  TNF signaling pathway
biu04714  Thermogenesis
biu04725  Cholinergic synapse
biu04728  Dopaminergic synapse
biu04911  Insulin secretion
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04922  Glucagon signaling pathway
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04931  Insulin resistance
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04962  Vasopressin-regulated water reabsorption
biu05016  Huntington disease
biu05020  Prion disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109569868 (CREB3L1)
   04024 cAMP signaling pathway
    109569868 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    109569868 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    109569868 (CREB3L1)
   04152 AMPK signaling pathway
    109569868 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109569868 (CREB3L1)
   04922 Glucagon signaling pathway
    109569868 (CREB3L1)
   04915 Estrogen signaling pathway
    109569868 (CREB3L1)
   04926 Relaxin signaling pathway
    109569868 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    109569868 (CREB3L1)
   04918 Thyroid hormone synthesis
    109569868 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    109569868 (CREB3L1)
   04916 Melanogenesis
    109569868 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    109569868 (CREB3L1)
   04927 Cortisol synthesis and secretion
    109569868 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109569868 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109569868 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    109569868 (CREB3L1)
   04728 Dopaminergic synapse
    109569868 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    109569868 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    109569868 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109569868 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    109569868 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109569868 (CREB3L1)
   05020 Prion disease
    109569868 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    109569868 (CREB3L1)
   05031 Amphetamine addiction
    109569868 (CREB3L1)
   05034 Alcoholism
    109569868 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109569868 (CREB3L1)
   04934 Cushing syndrome
    109569868 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109569868 (CREB3L1)
   05161 Hepatitis B
    109569868 (CREB3L1)
   05163 Human cytomegalovirus infection
    109569868 (CREB3L1)
   05165 Human papillomavirus infection
    109569868 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109569868 (CREB3L1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109569868 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 Spc29 ELP6 Jnk-SapK_ap_N HAUS-augmin3 APG6_N TPR_MLP1_2 Prominin JMY RNase_Y_N ADIP DUF4404 DUF724
Other DBs
NCBI-GeneID: 109569868
NCBI-ProteinID: XP_019831189
UniProt: A0A6P5D1F1
LinkDB
Position
15
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPVVPIKMEDTTQDVEHGAWVLG
HKLCSVMVKQEQSPELPVDPLAASSAMAAAAAMATTPLLGLSPLTRLPVPHQAPGEMTQL
PVIKAEPQEVHQFLKVTPEDLLQMPPTPPSSHGSDSDGSQSPRSLPPSSPIRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLVAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTSK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPMATDSVYAASQM
PSRSLLFYDEGAGSWEDGRSALLPVEPPDGWEIKPGGPVEQRPQDHLQHDHLDSTHETSK
YLSEAWPKDVGGNSTGPDFSHPKEWFHERDLGPNTTVKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggagcccttcccggccgacaggctgtttcccggatccagcttcctg
gacttgggggatctgaacgagtcggatttcctcaacaatgcgcacttccccgagcacctg
gaccactttgcagagaacatggaggacttctccaacgacctgttcagcagtttctttgat
gaccctgtgytggacgagaagagccctctcctggacatggaactggactcccccacgccg
ggcatccaggccgagcacagctactccctgagcggtgactcggcgcctcagagccccgtc
gtgcccatcaagatggaagacaccacccaagatgtggaacatggagcrtgggtgctgggg
cacaaactgtgctcagtcatggtgaagcaggaacagagcccggagctgcccgtggaccct
ctggccgcctcctcggccatggccgccgccgctgccatggccaccaccccgctgctgggc
ctcagccccctgaccaggctgcccgtcccccaccaggccccaggagagatgactcagctg
ccagtgatcaaagccgagccccaggaggtgcaccagttcctcaaagtgacaccagaggac
ctgctgcagatgcctccgacgccccccagcagccacggcagcgacagcgacggctcccag
agtccccgctctctgcccccttccagcccaatccggcccatggcccgctcctccacggcc
atctccacctctccgctcctcaccgcccctcataaattacaggggacgtcggggccgctg
ctcctgacggaggaggagaagcgcaccctggttgctgagggctatcccatycccaccaaa
ctccccctcaccaaagccgaggagaaggccttgaagagggtccggaggaagatcaagaac
aagatctcggcccaggagagccgccgtaagaagaaggaatacgtggagtgtctagaaaag
aaggtggagacatttacatctgagaacaacgaactgtggaagaaggtggaaacgctggag
aatgccaacaggactctgctccagcagctgcagaaactccagactctggtcaccagcaag
atctccagaccttacaagatggcagccacccagaccgggacctgcctcatggtggcagcc
ttgtgctttgtcctggtgctgggctccctcgtgccctgcctccctgagttctcctctggc
tcccagactgtgaaggaagacccgatggccactgacagcgtctacgccgccagtcagatg
ccctcccggagcctcctgttctacgacgagggagcaggctcgtgggaggatggccgcagt
gccctgctgcctgtggagccccccgatggctgggagatcaagcccggggggccggtggag
cagcgaccccaggaccacctgcaacatgaccacctggacagcacccacgagaccagcaag
tacctgagtgaggcctggccaaaggacgtcggtgggaacagcacgggtcctgacttctcc
caccctaaggagtggttccatgagagggatctgggtcccaacaccaccgtcaagctctcc
tag

KEGG   Bos indicus (zebu cattle): 109570093
Entry
109570093         CDS       T04792                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04261  Adrenergic signaling in cardiomyocytes
biu04380  Osteoclast differentiation
biu04612  Antigen processing and presentation
biu04668  TNF signaling pathway
biu04710  Circadian rhythm
biu04713  Circadian entrainment
biu04714  Thermogenesis
biu04725  Cholinergic synapse
biu04728  Dopaminergic synapse
biu04911  Insulin secretion
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04922  Glucagon signaling pathway
biu04924  Renin secretion
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04931  Insulin resistance
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04962  Vasopressin-regulated water reabsorption
biu05016  Huntington disease
biu05020  Prion disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05203  Viral carcinogenesis
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109570093 (CREB1)
   04024 cAMP signaling pathway
    109570093 (CREB1)
   04022 cGMP-PKG signaling pathway
    109570093 (CREB1)
   04151 PI3K-Akt signaling pathway
    109570093 (CREB1)
   04152 AMPK signaling pathway
    109570093 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    109570093 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    109570093 (CREB1)
   04922 Glucagon signaling pathway
    109570093 (CREB1)
   04915 Estrogen signaling pathway
    109570093 (CREB1)
   04926 Relaxin signaling pathway
    109570093 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    109570093 (CREB1)
   04918 Thyroid hormone synthesis
    109570093 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    109570093 (CREB1)
   04916 Melanogenesis
    109570093 (CREB1)
   04924 Renin secretion
    109570093 (CREB1)
   04925 Aldosterone synthesis and secretion
    109570093 (CREB1)
   04927 Cortisol synthesis and secretion
    109570093 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109570093 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109570093 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    109570093 (CREB1)
   04728 Dopaminergic synapse
    109570093 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109570093 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    109570093 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    109570093 (CREB1)
   04713 Circadian entrainment
    109570093 (CREB1)
   04714 Thermogenesis
    109570093 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109570093 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    109570093 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109570093 (CREB1)
   05020 Prion disease
    109570093 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    109570093 (CREB1)
   05031 Amphetamine addiction
    109570093 (CREB1)
   05034 Alcoholism
    109570093 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109570093 (CREB1)
   04934 Cushing syndrome
    109570093 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109570093 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109570093 (CREB1)
   05161 Hepatitis B
    109570093 (CREB1)
   05163 Human cytomegalovirus infection
    109570093 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109570093 (CREB1)
   05165 Human papillomavirus infection
    109570093 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109570093 (CREB1)
   03029 Mitochondrial biogenesis [BR:biu03029]
    109570093 (CREB1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109570093 (CREB1)
Mitochondrial biogenesis [BR:biu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    109570093 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 109570093
NCBI-ProteinID: XP_019831457
UniProt: A0A6P5D249
LinkDB
Position
2
AA seq 341 aa
MTMESGAENQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaagccagcaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcacgcaacatcatctgctcccaccgtaactttagtacagctgcccaat
gggcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaaccgat
tcccaaaaacgaagagagattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaaatctgaagaggagact
tcagcacctgccatcaccactgtcacggtgccaactccgatttatcagactagcagtgga
cagtatattgccattacccaaggaggagcaatacaactggctaacaatggtactgatggg
gtacagggcctgcagacattaaccatgaccaatgcagctgccactcagccaggtactacc
atcctgcagtatgcacagaccactgatggacagcaaatcctagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacagacataccagattcgcacagcgcccactagc
accattgcccctggagttgttatggcgtcttccccagcacttcctacacagcctgctgaa
gaagcggcgcgaaagagagaggttcgcctcatgaagaacagggaagcagcacgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtctagaaaacagagtggcagtgcttgaaaat
caaaacaagacactgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Bos indicus (zebu cattle): 109576848
Entry
109576848         CDS       T04792                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04022  cGMP-PKG signaling pathway
biu04141  Protein processing in endoplasmic reticulum
biu04151  PI3K-Akt signaling pathway
biu04211  Longevity regulating pathway
biu04261  Adrenergic signaling in cardiomyocytes
biu04668  TNF signaling pathway
biu04728  Dopaminergic synapse
biu04911  Insulin secretion
biu04915  Estrogen signaling pathway
biu04918  Thyroid hormone synthesis
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu05020  Prion disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109576848 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109576848 (ATF6B)
   04022 cGMP-PKG signaling pathway
    109576848 (ATF6B)
   04151 PI3K-Akt signaling pathway
    109576848 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109576848 (ATF6B)
   04915 Estrogen signaling pathway
    109576848 (ATF6B)
   04926 Relaxin signaling pathway
    109576848 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    109576848 (ATF6B)
   04918 Thyroid hormone synthesis
    109576848 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    109576848 (ATF6B)
   04925 Aldosterone synthesis and secretion
    109576848 (ATF6B)
   04927 Cortisol synthesis and secretion
    109576848 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109576848 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    109576848 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    109576848 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109576848 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    109576848 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    109576848 (ATF6B)
   05031 Amphetamine addiction
    109576848 (ATF6B)
   05034 Alcoholism
    109576848 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109576848 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109576848 (ATF6B)
   05161 Hepatitis B
    109576848 (ATF6B)
   05163 Human cytomegalovirus infection
    109576848 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109576848 (ATF6B)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109576848 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 109576848
NCBI-ProteinID: XP_019841038
UniProt: A0A6P5DRM1
LinkDB
Position
23
AA seq 723 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEVAEEQTELFRCPEQDVPVSLPKP
CLSPLFGSSSLDLGMDVSPPEPPWDSLPIFPARFPPDLQVKSEPSSPCSSSSLSSESSHL
STEPSNQAPGVGEMLVVKSESLAPPLCLLGDDPTSPFETIQINVSTXSDDPSDVQIKIEP
ASPSSSINSEAPLLSAESPSQAFIGEEVLEVKTESPSPQGCLLRDVPGPXPGAVQISMGL
SSDGSSGKALPARKPPLQPKPMLITTVPIPPRAVPXSTTVLLQPLVQPPPVSPVVLIQGT
VRVQPEGPTPPPPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKK
EYLQGLEARLQAVLADNQQLRRENAALRRRLEALLTENSELKLGSGNRKVVCVMVFLLFI
AFNFGPVSISEPPPASISPRMSRGESRPRRHLLEFSAQEPVHGAEPRQHPFQDPEEPQPS
PAGHPSFRNLTAFPGDTRELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGR
RKTPQRAQEKQKSQFRKKSPPVQAVPTRPPGPPEGDSVGQLQLYRQPDRSQPEFLDAIDR
REDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIEC
EVMDTRVIHIKTSTVPPSLRKQPSSTPGNATGGPLPASAAASQAHQAAHQPSTSIISDLY
DSH
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggcggagctgatgcttctcagcgagattgcggacccgacacgctttttcaccgacaac
ttgctgagcccggaggactgggacagcactttgtacgccggcttggaygaagtggccgag
gagcagacggagctcttccgttgtccggagcaagatgtcccggtatcgctccccaagcct
tgtctctcaccgttgtttggcagcagctctctggacctgggaatggacgtcagccctcct
gaacccccctgggactctctgcctatcttcccagcccgttttcctccagatctccaggtg
aagtctgagccatcctccccctgctcttcctcctccctcagctctgaatcatcgcatctt
tccacagagccctccaaccaggcccctggtgtaggggagatgctggttgtgaagtcagag
tccttggcacccccactctgcctcctgggagatgatccaacatccccatttgaaaccatc
cagatcaatgtcagcaccayctctgatgatccttcagatgttcagattaagatagagcct
gcctctccatcttcctccatcaactcggaggctcccctgctctctgcagagtcccccagc
caggctttcataggagaggaggtcctggaagtgaagacagagtccccgtcccctcagggg
tgtctcctgcgggatgtccccggccccyctcctggagctgtccagatcagcatgggcctg
tcctctgacggctcctcaggcaaagccctgccygcccggaagccaccactgcagcccaaa
cccatgctgataaccactgtcccgatacccccgagagctgtgcctrccagcaccaccgtc
ctcttgcagccccttgtccagccacccccagtgtccccagttgtcctcatccaaggtact
gttcgagtccagcctgagggaccgacccctcctcctccacggcctgagaggaagagcatt
gttccagcccctatgcctgggaactcctgccctcctgaggtggatgccaagctgctgaag
cggcagcagcggatgatcaagaaccgggagtcagcctgccagtcccgcaggaagaagaaa
gagtacctgcaggggctggaagcccggctgcaagccgtgctggccgacaaccagcagctc
cggcgggagaatgctgccctccgccggcggctggaggccctgctgactgagaacagcgag
ctcaagttagggtctggaaacaggaaggtggtctgcgtcatggtcttccttctcttcatc
gctttcaactttgggcctgtgagcatcagtgagcctcctccggcttccatctctcctcgg
atgagcagaggggagtctcgaccccggagacacttgctggagttctcggcacaagagcca
gttcatggagccgagccccgccagcatcccttccaggaccctgaggagccccagcccagc
cccgctggccacccaagtttcaggaacctgacagccttccctggggacaccagggagctg
ctgctgagagacctggaccagctcttcctctcctcggattgccggcactttaaccgaacc
gagtccctgaggcttgctgacgagctgagtggctgggtccagcgycaccagagaggccgg
cggaagacacctcagagagcccaggagaaacagaagtctcagtttcggaagaagtctcct
ccagttcaggcagtccccacccgcccccctgggcccccggaaggggattccgtgggccag
ctgcagctgtaccgccaaccagaccgttcgcagcccgagttcctggatgcaattgaccga
cgggaagacacattttacgttgtctccttccgaagggaccacttgctgctcccagccatc
agccacaacaagacctcccggcccaagatgtcyctggtgatgcctgctatggcccccaat
gagaccctgtcaggccggggaccccctggggactatgaggagatgatgcagatcgagtgt
gaggtcatggataccagggtgattcacatcaagacctccacagtgcccccctcgctacga
aaacagccgtcctcaaccccgggcaatgccacaggtggccccttgccagcttctgcagca
gccagccaggctcaccaggctgcccatcagccctctacctcaatcatctctgacctctat
gactcacactga

DBGET integrated database retrieval system