KEGG   Bos indicus (zebu cattle): 109554439
Entry
109554439         CDS       T04792                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04115  p53 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04340  Hedgehog signaling pathway
biu04371  Apelin signaling pathway
biu04390  Hippo signaling pathway
biu04510  Focal adhesion
biu04530  Tight junction
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04921  Oxytocin signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04934  Cushing syndrome
biu05160  Hepatitis C
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05216  Thyroid cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109554439 (CCND1)
   04340 Hedgehog signaling pathway
    109554439 (CCND1)
   04390 Hippo signaling pathway
    109554439 (CCND1)
   04371 Apelin signaling pathway
    109554439 (CCND1)
   04630 JAK-STAT signaling pathway
    109554439 (CCND1)
   04068 FoxO signaling pathway
    109554439 (CCND1)
   04151 PI3K-Akt signaling pathway
    109554439 (CCND1)
   04152 AMPK signaling pathway
    109554439 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109554439 (CCND1)
   04115 p53 signaling pathway
    109554439 (CCND1)
   04218 Cellular senescence
    109554439 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109554439 (CCND1)
   04530 Tight junction
    109554439 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109554439 (CCND1)
   04921 Oxytocin signaling pathway
    109554439 (CCND1)
   04919 Thyroid hormone signaling pathway
    109554439 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109554439 (CCND1)
   05206 MicroRNAs in cancer
    109554439 (CCND1)
   05205 Proteoglycans in cancer
    109554439 (CCND1)
   05203 Viral carcinogenesis
    109554439 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109554439 (CCND1)
   05212 Pancreatic cancer
    109554439 (CCND1)
   05225 Hepatocellular carcinoma
    109554439 (CCND1)
   05226 Gastric cancer
    109554439 (CCND1)
   05214 Glioma
    109554439 (CCND1)
   05216 Thyroid cancer
    109554439 (CCND1)
   05221 Acute myeloid leukemia
    109554439 (CCND1)
   05220 Chronic myeloid leukemia
    109554439 (CCND1)
   05218 Melanoma
    109554439 (CCND1)
   05219 Bladder cancer
    109554439 (CCND1)
   05215 Prostate cancer
    109554439 (CCND1)
   05213 Endometrial cancer
    109554439 (CCND1)
   05224 Breast cancer
    109554439 (CCND1)
   05222 Small cell lung cancer
    109554439 (CCND1)
   05223 Non-small cell lung cancer
    109554439 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109554439 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109554439 (CCND1)
   04934 Cushing syndrome
    109554439 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109554439 (CCND1)
   05162 Measles
    109554439 (CCND1)
   05160 Hepatitis C
    109554439 (CCND1)
   05163 Human cytomegalovirus infection
    109554439 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109554439 (CCND1)
   05169 Epstein-Barr virus infection
    109554439 (CCND1)
   05165 Human papillomavirus infection
    109554439 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109554439 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109554439
NCBI-ProteinID: XP_019810509
LinkDB
Position
29
AA seq 295 aa
MAHQLLCCEMETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLHMELVLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVAAAAQGLHLGSANGFLSYHRLTRFLSKVIRCD
PDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEEEEEEEVDLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgagatggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgagtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaagaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatttacactgacaactccatccggcccgacgagctgctgcacatg
gagctggtcctggtgaacaaactcaagtggaacctggcggccatgaccccgcacgacttc
atcgagcacttcctctccaagatgccggtggccgaggagaacaagcagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagacgtgaagttcatttccaacccgccc
tccatggtggccgccgggagcgtggcggccgcggctcaaggcctgcatctgggaagcgcc
aacggcttcctctcctatcaccgcctgacgcggttcctctccaaggtgatcagatgtgac
ccggactgcctccgcgcctgccaggagcagatcgaagccctcctggagtccagcctgcgc
caggcccagcagcagaacttggaccccaaagccgcrgaggaggaagaggaggaggaggag
gtggacctggcctgcacgcccaccgacgtgcgtgacgtgaacatctga

DBGET integrated database retrieval system