KEGG   Bos indicus (zebu cattle): 109554630
Entry
109554630         CDS       T04792                                 

Gene name
FOSL1
Definition
(RefSeq) fos-related antigen 1
  KO
K04502  fos-like antigen 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04310  Wnt signaling pathway
biu04380  Osteoclast differentiation
biu04657  IL-17 signaling pathway
biu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109554630 (FOSL1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    109554630 (FOSL1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109554630 (FOSL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109554630 (FOSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109554630 (FOSL1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    109554630 (FOSL1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 Macoilin TMCO5 DUF4407 UPF0242
Other DBs
NCBI-GeneID: 109554630
NCBI-ProteinID: XP_019810826
UniProt: A0A6P5B1M5
LinkDB
Position
29
AA seq 271 aa
MFRDYGEPGPSSGAVVAYGGPTQPPATGQQKFHLVPSINTVSGNQELQWMVQPHFLGPSS
YPRPLAYPPYSPPQPRPGVIRALGPTPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCR
NRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKESET
SGTGGASGTSSPPXPSRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPST
PEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
NT seq 816 nt   +upstreamnt  +downstreamnt
atgttccgagactacggggaaccgggaccgagctccggcgccgtcgttgcgtacggcggc
ccgactcagcccccggccacaggccagcagaagttccacctcgtgccaagcatcaacact
gtgagtggcaaccaggagcttcagtggatggttcaacctcacttcctgggacccagcagc
taccccaggcctctggcctatcccccgtacagtcccccgcagccccggccaggagtcata
cgggccctgggcccaactccaggggtgcgtcgccggccctgtgaacagatcagccccgag
gaggaggaacgccgtcgagtgaggcgggagaggaacaagctagccgcggccaagtgcagg
aaccggaggaaagaattgaccgacttcctgcaggcggagaccgacaaactggaggatgag
aaatctggactgcagcgagagattgaggagctgcagaaacagaaggagcgcctggagctg
gtgctcgaagcccaccgccccatctgcaaaatcccagaaggggccaaggagagcgaaacc
agcggcacaggtggtgccagcggcaccagcagcccgccagrcccctcccgccctgtgcca
tgtatctccctttccccagggcctgtacttgaacccgaagcattgcacactcccacgctc
atgaccacaccctccctgactcctttcacccccagtctggtcttcacctaccccagtacg
ccagagccctgtgcctcagcccatcgcaagagtagcagcagcagtggggacccctcttct
gatcccctgggctccccaaccctcctggccttatga

DBGET integrated database retrieval system