KEGG   Bos indicus (zebu cattle): 109555079
Entry
109555079         CDS       T04792                                 

Gene name
FHL1
Definition
(RefSeq) four and a half LIM domains protein 1 isoform X1
  KO
K14365  four and a half LIM domains protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109555079 (FHL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:biu04990]
    109555079 (FHL1)
Domain-containing proteins not elsewhere classified [BR:biu04990]
 LIM domain-containing proteins
  FHL family proteins
   109555079 (FHL1)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 109555079
NCBI-ProteinID: XP_019811192
UniProt: A0A6P5BEP9
LinkDB
Position
X
AA seq 339 aa
MASHRHSGPSSYKVGTMAEKFDCHYCRDNLQGKKYVQKDGHHCCLKCFDKFCANTCVQCR
KPIGADSKEVHYKNXYWHDTCFRCSKCLQPLASETFVAKDNKILCNKCTTREDNPKCKGC
LKPIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHEAKFAKHCVK
CNKAITSGGITYQDQPWHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGKRTVSRVSHPVSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLY
RKNRSLAAPRGPGLVKAPVWWPMKDNPGTTTASTAKNAP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcttcccatagacactcaggtccttccagctataaagtaggcaccatggctgagaag
ttcgactgccactactgcagagacaacctgcaggggaagaagtacgtgcagaaggacggc
caccactgctgcctcaagtgcttcgacaagttctgcgccaacacgtgtgtgcagtgccgc
aagcccatcggcgccgactccaaggaggtgcactacaagaaccrctactggcacgacacc
tgcttccgctgctctaagtgcctccagcccttggccagtgagaccttcgtggccaaggac
aacaagatcctgtgcaacaagtgcaccactcgggaggacaaccccaagtgcaagggctgc
ctcaagcccattgtagcaggagatcagaacgtggaatacaagggcactgtctggcacaaa
gactgcttcacctgcagcaactgcaagcaagtcatcgggacaggaagcttcttccctaaa
ggggaggacttctactgcgtgacttgccatgaggccaagtttgccaagcactgcgtgaaa
tgcaacaaggccatcacatctggaggaatcacttaccaggatcagccctggcatgccgag
tgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttcaccgctgtggag
gaccagtattactgcgtggattgctacaagaactttgtggccaagaagtgtgctggatgc
aagaacccaatcactgggaaaaggactgtgtcaagagtgagccacccagtctctaaagct
aggaagcccccagtgtgccacgggaaacgcttgcctctcaccctgtttcccagcgccaac
ctccggggcaggcatccgggtggagagaggacttgtccctcgtgggtggtggttctttat
agaaaaaatcgaagcttagcagctcctcgaggcccgggtttggtaaaggctccagtgtgg
tggcctatgaaggacaatcctggcacgactactgcttccactgcaaaaaatgctccgtga

DBGET integrated database retrieval system