KEGG   Bos indicus (zebu cattle): 109555819
Entry
109555819         CDS       T04792                                 

Definition
(RefSeq) high affinity immunoglobulin gamma Fc receptor I-like
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04380  Osteoclast differentiation
biu04613  Neutrophil extracellular trap formation
biu04640  Hematopoietic cell lineage
biu04666  Fc gamma R-mediated phagocytosis
biu05140  Leishmaniasis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05202  Transcriptional misregulation in cancer
biu05221  Acute myeloid leukemia
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109555819
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109555819
   04613 Neutrophil extracellular trap formation
    109555819
   04666 Fc gamma R-mediated phagocytosis
    109555819
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109555819
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109555819
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109555819
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109555819
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109555819
   05152 Tuberculosis
    109555819
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109555819
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109555819
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109555819
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    109555819
CD molecules [BR:biu04090]
 Proteins
  109555819
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set Ig_4
Other DBs
NCBI-GeneID: 109555819
NCBI-ProteinID: XP_019812199
UniProt: A0A6P5BN54
LinkDB
Position
3
AA seq 349 aa
MWLIIALILGAPVAEQVDPTKAVITLKPPWVSVFQEENVTLLCEGPHRPGDTATQWFLNG
TAIKTLAPRYSINSATFDDSGEYKCQTGLSMLSDPVQLEIHSDWLLLQVTSRVFTEGDPL
ALRCHAWKNMPVYKMLFYKDGKPFRFSSQDSEFTILQTNLSHNGIYHCSGERRRRYTSAG
VSITIKELFPAPVLRTSFSSPHQEGNLVNLSCETKLPSEKPGQQLYFSFYVGNKTLISRT
TSSEYQTFIAKKEDRRLYWCEAATGDGNLIKRSPELELPVLGLQSTTPVWFHFLFYLAVG
IMFLVDSVLCIVIHKELQRKKMWNLEIYLDSLDSGHGKEVPPTFKNIDN
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgtggctcataatagctctgatccttggggctccagttgctgagcaagtggaccccaca
aaggcagtgatcaccttgaagcctccgtgggtcagtgtattccaagaagaaaatgtaacc
ttattgtgtgaggggccccaccggcctggggacactgctacacagtggtttctcaacggc
acagccatcaagaccctggcccccagatacagtattaacagtgctacattcgatgacagt
ggtgaatacaagtgccagacaggcctctcaatgctaagtgacccagtacagctagaaatc
cacagtgattggctactactccaggtcactagcagagtcttcacagaaggggaccctctg
gccttgaggtgtcatgcatggaagaatatgccggtgtacaaaatgcttttctacaaagat
ggcaagccctttaggttttctagtcaggattctgaattcaccattctgcaaaccaacttg
agtcacaatggcatctatcactgctcgggcgagagaaggcgtcgctacacatcggcagga
gtatctatcactataaaagagctatttccagccccagtgctgagaacatccttctcatcc
cctcaccaagaggggaatctggtcaacctgagctgtgaaacaaagttgccctcagagaag
cctggtcagcagctttacttctccttctatgtgggaaacaagaccctaataagcaggacc
acatcctctgaataccagacattcattgctaaaaaagaagaccgtaggctatactggtgt
gaagctgccacaggagatgggaatcttatcaagcgcagccctgagctggagcttccggtg
cttggcctccagtcaacaactcctgtctggtttcattttcttttctatctggcagtgggg
ataatgtttttggtggacagtgttttatgtattgtaatacataaggaactacaaagaaag
aaaatgtggaatttagaaatctatttggactctctggactctggtcatgggaaggaggta
cctcctaccttcaaaaacatagacaattaa

DBGET integrated database retrieval system