KEGG   Bos indicus (zebu cattle): 109555834
Entry
109555834         CDS       T04792                                 

Gene name
PIAS3
Definition
(RefSeq) E3 SUMO-protein ligase PIAS3 isoform X1
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04120  Ubiquitin mediated proteolysis
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109555834 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109555834 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109555834 (PIAS3)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     109555834 (PIAS3)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   109555834 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 109555834
NCBI-ProteinID: XP_019812225
UniProt: A0A6P5BN45
LinkDB
Position
3
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTPPVGSPGPLAPIPPALLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEIYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNPSESKKKVEVIDLTVESSSDEEDLPPTKKHCPVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLTPTLGSSHRSATPAPPPGRVSSIVAPG
GTLREGHGGPLPSGPSLTGCRSDIISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagtttccgggtgtctgagctccag
gtgctcctcggctttgctggccggaacaagagtggacggaagcacgagctcctggccaag
gccctacacctcctcaagtctagctgtgcccccagcgtccagatgaagatcaaagagctt
taccgccgacgctttccccgcaagaccctggggccctctgatctttctctgctctccttg
ccccctggaacccctcctgtaggctctcctggtcctctggctcccatccccccggccctc
ttggcccctggcaccctrctgggccccaagcgtgaagtggacatgcaccctcctctaccc
cagcctgtgcaccctgacgttaccatgaaaccattgcccttctatgaaatctacggggag
ctcatccggcctaccaccctagcatccacttctagccagcggttcgaggaagcgcacttc
acctttgccctcaccccccagcaagtgcagcagattcttacttccagagaggttctgcca
ggagccaaatgcgattataccatacaggtgcagttaaggttctgtctctgtgagaccagc
tgcccccaggaagattacttcccccccaacctctttgtcaaggtcaatgggaaactgtgc
cccctgccgggttaccttccccctaccaagaacggggctgagcccaagagacccagccgc
cccatcaacatcacacccctggctcgtctctcggccactgttcccaacaccatcgtggtt
aactggtcgtctgagtttggacggaattactccttgtccgtgtacctggtgaggcagctg
acggcagggaccctgctacaaaaactcagagcaaagggcatccggaacccagaccactcc
cgggcactgatcaaggagaagttgaccgctgacccggacagtgaggtggctactacgagt
ctccgggtgtcactcatgtgcccgctggggaagatgcgcttgactgtcccttgtcgcgcc
ctcacctgcgcccacctgcagagcttcgatgctgccctttatctacagatgaatgagaag
aaaccaacgtggacatgtcctgtgtgtgacaagaaagctccctatgaatctcttatcatt
gatggtttattcatggagattcttaattcctgctcggattgtgatgagatccagttcatg
gaagatggatcctggtgcccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtatagcccagtccaagagggcaatccatcggag
agtaagaagaaggttgaagttattgacttgacagtagaaagctcatcagatgaggaggac
ctgcccccgacgaagaagcactgtcctgtcacgtcagctgccatcccggctcttcctgga
agcaaaggagtcctgacatctggtcaccagccatcttcggtgctgcggagccctgctatg
ggcacgctgggyggggatttcctgtccagtctcccactacatgagtacccgcccgccttc
cccctcggggctgatatccaaggtttagatttattttcttttcttcagactgagagtcag
cactatggtccctccgtcatcacctcactagatgaacaggatgccctgggccacttcttc
cagtaccgagggaccccttcccacttcctgggcccgctcacccccacgttggggagctct
caccgcagcgccacgccggcaccccctcctggccgtgtcagtagcattgtggcccctgga
ggcaccttaagggagggccatggaggacccctgccctcaggtccctctttgactggctgt
cggtcagacatcatttccctggactga

KEGG   Bos indicus (zebu cattle): 109561754
Entry
109561754         CDS       T04792                                 

Gene name
PIAS4
Definition
(RefSeq) E3 SUMO-protein ligase PIAS4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04064  NF-kappa B signaling pathway
biu04120  Ubiquitin mediated proteolysis
biu04630  JAK-STAT signaling pathway
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109561754 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561754 (PIAS4)
   04064 NF-kappa B signaling pathway
    109561754 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109561754 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109561754 (PIAS4)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109561754 (PIAS4)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   109561754 (PIAS4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP CENP-B_dimeris
Other DBs
NCBI-GeneID: 109561754
NCBI-ProteinID: XP_019820014
UniProt: A0A6P5C322
LinkDB
Position
7
AA seq 513 aa
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKSSEPVPQPHRPLDPLTMHSTYERASSVPRTPLTGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSR
ELQPGVKAVQVVLRICYSDTSSPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPC
RPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCK
ALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKK
PTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQCP
ILVLGTSDANGLLSTPSVNGGGGSVLGGAGSGGGPVGSVENGKPGADVVDLTLDSSSSSE
EEEEEEEDEEDEDEEGPRPKRRCPFQKGLVSAC
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggcggcggaactggtggaggccaaaaacatggtgatgagtttccgagtctccgacctt
cagatgctcctgggttttgtcggccggagtaagagtggacttaaacatgaacttgtcacg
cgggccctccagctggtccagtttgactgtagccccgagctgttcaagaaaatcaaggag
ctctatgagacacgctacgccaagaagagctcagagcctgtaccccaaccccaccggccc
ctggaccccctgaccatgcactccacctatgagcgggccagctcggtacccaggactccc
ctcacaggccccaacattgactatcccgtgctctacgggaagtacttaaacggacttgga
cggttgcctgccaagactctcaagccagaagtgcgcctggtgaagctgcccttcttcaac
atgttggatgagttgctaaagcctaccgagctggttccacagaataacgagaagcttcag
gagagcccctgcatcttcgccttgacccccagacaggtggagctgatccggaactccaga
gaactgcagcctggggtcaaggccgtgcaggttgtcctaagaatctgctattcagacacc
agcagccctcaggaagaccagtacccacccaatatcgccgtgaaggtcaaccacagctac
tgctcggtgccgggctactacccctcaaacaagcctggagtggagcccaagaggccgtgc
cgccccatcaacctcacccacctcatgtacctgtcctcggccaccaaccgcatcactgtc
acctggggcaactacggcaagagttattccgtggccttgtacctggtgcggcagctgacc
tcctcggagctgctgcagaggttgaagaccatcggggtcaagcacccggagctgtgcaag
gcactggtcaaagagaagctgcgcctggaccctgacagtgagatcgccaccacgggcgtg
cgggtctccctcatctgcccgctggtgaagatgcgtctgtcggtgccctgccgcgcggag
acctgcgcgcacttgcagtgcttcgacgcagtcttctacctccagatgaacgagaagaag
cccacctggatgtgcccggtgtgtgacaagccrgccccttatgaccagctcatcatcgac
gggctcctctccaagatcctgagcgagtgcgaggacgcggacgagattgagtacctggtg
gacggctcgtggtgcccgattcgcgccgagaaggagcgcagctgcagcccccagtgccct
atccttgtgctcggcacctcggacgccaatgggctcctctctacccccagcgtcaacggc
gggggcggcagcgtgcttgggggtgcgggcagcggaggcggcccagtgggcagcgtggag
aatgggaagccgggagctgatgtggtggacctaacgctggacagctcgtcgtcctcagag
gaggaagaggaagaagaggaggatgaggaggacgaggacgaggagggcccccggccaaag
cgccgctgccccttccaaaagggtctggtgtcggcctgctga

KEGG   Bos indicus (zebu cattle): 109564711
Entry
109564711         CDS       T04792                                 

Gene name
PIAS1
Definition
(RefSeq) E3 SUMO-protein ligase PIAS1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04120  Ubiquitin mediated proteolysis
biu04630  JAK-STAT signaling pathway
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109564711 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109564711 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109564711 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109564711 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:biu04812]
    109564711 (PIAS1)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     109564711 (PIAS1)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   109564711 (PIAS1)
Cytoskeleton proteins [BR:biu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    109564711 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 109564711
NCBI-ProteinID: XP_019823740
UniProt: A0A6P5CDG7
LinkDB
Position
10
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKSKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHGHTVANRSSSDTAAIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtactgttgggctacgctgggagaaacaagcacggacgcaaacacgaactsctcacaaaa
gccctgcatttgctcaaggctggctgcagtcccgctgtgcaaatgaaaattaaagaactc
tataggcggaggttcccccagaaaatcatgacgcctgcggacttgtccatccccaacgta
cattcaagtcctatgccagcaactttgtctccatctaccattccacaactcacttatgat
ggtcaccctgcatcatcaccgttactccctgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacatcagctcttcacccagtccatccggatataaaacttcaaaaa
ttaccattttatgatttactggatgaactgataaaacccaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgttttgcatttgcattgacgccacaacaagtgcagcag
atcagtagttccatggatatttctgggaccaaatgtgacttcacagtgcaggtccagtta
aggttttgtttatcagaaaccagttgtccacaagaagatcacttcccacccaatctttgt
gtgaaagtgaatacaaaaccttgcagccttccaggttatcttccacctactaaaaatggt
gtggaaccaaagcgacccagccgaccaattaatatcacctcacttgtccgattgtctaca
actgtaccaaacaccattgttgtttcttggactgcagaaattggaagaaactattccatg
gcagtgtatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaacccggatcattctagagctttaattaaagagaagttgactgcggatcca
gacagtgaaatagctacaaccagcctgagggtttctctactatgtccacttggtaaaatg
cggctgacaattccatgtcgggccctcacatgttctcatctgcagtgttttgatgcaact
ctttatattcagatgaatgagaaaaaaccaacttgggtttgtcctgtctgtgataagaag
gccccatatgaacacctgattattgatggcttgtttatggaaatcctaaagtactgtaca
gattgtgatgaaatacagtttaaggaggacggctcttgggcacctatgagatcaaaaaag
gaagtacaggaagtttctgcctcttacaatggagttgatggatgcttaagctccacatta
gagcaccaagtggcttctcatcaccagtcttcaaataaaagtaagaaagtagaggtgatt
gatctaaccatagacagttcatcagatgaagaagaagaagagccatctgccaagagaacc
tgtccttccctgtctcccacatcgccactaaataataaaggcatactgagtcttccacat
caagcatctccagtgtcccgcaccccaagcctccctgctgtagacacaagctatattaac
acatccctcatccaagactacagacatcctttccacatgacacccatgccttatgactta
caagggttagatttctttcctttcttatcaggagacaatcagcactataacacctccctc
cttgctgcagcagcagcagcagtttcagatgatcaagacctcttacactcgtctcggttt
tttccatatacctcctcacagatgtttctcgatcagttaagtgcaggaggcagtacttct
ctgccaaccaccaatggaagcagtagtggcagtaacagcagccttgtatcctccaacagc
ctaagggagagccatggccacaccgtcgcgaacaggagcagctcggacacggcagccatc
tttggcatcataccagacattatttcattggactga

KEGG   Bos indicus (zebu cattle): 109577794
Entry
109577794         CDS       T04792                                 

Gene name
PIAS2
Definition
(RefSeq) E3 SUMO-protein ligase PIAS2 isoform X1
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04120  Ubiquitin mediated proteolysis
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109577794 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109577794 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109577794 (PIAS2)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     109577794 (PIAS2)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   109577794 (PIAS2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 109577794
NCBI-ProteinID: XP_019842191
UniProt: A0A6P5DV78
LinkDB
Position
24
AA seq 622 aa
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLSDLSAIKSPVFSLDGSSSPVEPDLAVAGIHALPSTSVTPHSPSSPVGS
VLLQDTKPAFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCTDVDEIKFQE
DGSWCPMRPKKEAMKVSTQPCPKIETSTVLSKPCAVTVAXEPSKKKVDVIDLTVESSSDE
EEGPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTP
ISSMSSDLPGLDFLSLIPVDPQQYCPPMFLDSLTSPLTASSASVTTTSPHESSTHVSSSS
SRSETGVITSSGSNIPDIISLD
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggcggatttcgaggagttgaggaatatggtttctagttttagggtttctgaactacaa
gtgttactaggctttgccggacggaataaaagtggacgtaagcatgacctcctgatgagg
gcgttgcatttattgaagagtggctgcagccctgcggttcagattaaaatccgagaattg
tatagacgccgataccctcggactctcgaaggcctttctgatttatctgcaatcaaatca
ccagttttcagtttggatggtagctcctcacctgtagaacctgacttggctgtggctgga
atccacgcgttgccttccacttcagttacacctcattctccgtcctctcctgttggttct
gtgctgcttcaagatactaaacccgcatttgagatgcagcagccatctcccccaatccct
cctgtccatcctgatgtgcagttaaaaaacttacccttttatgatgtccttgatgttctc
atcaagcccacgagtttagttcaaagcagtattcagcggtttcaagagaagttttttatt
tttgctctcacacctcagcaagttagagagatatgcatatccagggattttttgccaggt
ggtaggagagattatacagtacaagttcagctgagactttgcctggcagagacaagttgt
cctcaagaagataactatcccaatagtctctgtataaaagtgaatgggaagctgtttcct
ttgcctggctatgcaccaccacctaaaaatggaattgagcagaagcgccctggacgccct
ttgaatatcacgtctttagttaggttatcctcagctgtgccaaaccagatttccatttct
tgggcatcagaaattggaaagaattactccatgtctgtatatcttgtacgacaactcaca
tcagccatgttattacagagattaaaaatgaaaggtattagaaaccctgatcattccaga
gcactaattaaagaaaaacttactgcggatcctgacagtgagattgctaccactagcctt
cgggtgtccttgatgtgccctttagggaaaatgaggctgacaatcccatgccgtgcggtg
acttgtacacacctacagtgttttgatgctgccctttatctgcaaatgaatgagaagaaa
cccacctggatttgtcctgtgtgtgacaaaaaagctgcctatgaaagtctaattttagat
gggctttttatggaaattctcaatgactgtactgatgtggacgagatcaaattccaagaa
gatggttcttggtgtccaatgagaccgaagaaagaagctatgaaagtatccacccaacca
tgtcccaaaatagaaacttcaactgtcctcagtaagccrtgtgcagtgactgtagccart
gagccaagcaagaagaaagtggatgtcattgacctaacagtagaaagctcttctgatgaa
gaggaaggccctcctgccaaaaggaaatgcatctttatgtcagaaacacaaagcagccca
accaaaggggttctcatgtatcagccatcttctgtaagggtgcccagtgtgacttcggtt
gatcctgctgctattccgccttcattaacagactactcagtaccattccaccacacgcca
atctcaagcatgtcctcagatctgccaggtttggattttctttcccttattccagttgat
ccccagcagtactgtcctcctatgtttttggatagtctcacctcacccttaacagcaagc
agtgcgtctgtcaccaccaccagcccccatgagagcagtactcatgttagttcatccagc
agcaggagtgagacaggggtcataaccagcagtggaagtaacattcctgacatcatctca
ctggactaa

DBGET integrated database retrieval system