KEGG   Bos indicus (zebu cattle): 109555842
Entry
109555842         CDS       T04792                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00230  Purine metabolism
biu01100  Metabolic pathways
biu01522  Endocrine resistance
biu04015  Rap1 signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04114  Oocyte meiosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04611  Platelet activation
biu04713  Circadian entrainment
biu04714  Thermogenesis
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04727  GABAergic synapse
biu04728  Dopaminergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04913  Ovarian steroidogenesis
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04921  Oxytocin signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04924  Renin secretion
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu04976  Bile secretion
biu05012  Parkinson disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05032  Morphine addiction
biu05034  Alcoholism
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109555842 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109555842 (ADCY5)
   04371 Apelin signaling pathway
    109555842 (ADCY5)
   04072 Phospholipase D signaling pathway
    109555842 (ADCY5)
   04024 cAMP signaling pathway
    109555842 (ADCY5)
   04022 cGMP-PKG signaling pathway
    109555842 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109555842 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109555842 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109555842 (ADCY5)
   04062 Chemokine signaling pathway
    109555842 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    109555842 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    109555842 (ADCY5)
   04912 GnRH signaling pathway
    109555842 (ADCY5)
   04913 Ovarian steroidogenesis
    109555842 (ADCY5)
   04915 Estrogen signaling pathway
    109555842 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    109555842 (ADCY5)
   04921 Oxytocin signaling pathway
    109555842 (ADCY5)
   04926 Relaxin signaling pathway
    109555842 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    109555842 (ADCY5)
   04918 Thyroid hormone synthesis
    109555842 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    109555842 (ADCY5)
   04916 Melanogenesis
    109555842 (ADCY5)
   04924 Renin secretion
    109555842 (ADCY5)
   04925 Aldosterone synthesis and secretion
    109555842 (ADCY5)
   04927 Cortisol synthesis and secretion
    109555842 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109555842 (ADCY5)
   04270 Vascular smooth muscle contraction
    109555842 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    109555842 (ADCY5)
   04971 Gastric acid secretion
    109555842 (ADCY5)
   04972 Pancreatic secretion
    109555842 (ADCY5)
   04976 Bile secretion
    109555842 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    109555842 (ADCY5)
   04727 GABAergic synapse
    109555842 (ADCY5)
   04725 Cholinergic synapse
    109555842 (ADCY5)
   04728 Dopaminergic synapse
    109555842 (ADCY5)
   04726 Serotonergic synapse
    109555842 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    109555842 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109555842 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    109555842 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    109555842 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109555842 (ADCY5)
   04714 Thermogenesis
    109555842 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109555842 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109555842 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    109555842 (ADCY5)
   05031 Amphetamine addiction
    109555842 (ADCY5)
   05032 Morphine addiction
    109555842 (ADCY5)
   05034 Alcoholism
    109555842 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109555842 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109555842 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109555842 (ADCY5)
   05163 Human cytomegalovirus infection
    109555842 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109555842 (ADCY5)
Enzymes [BR:biu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109555842 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD PEN-2
Other DBs
NCBI-GeneID: 109555842
NCBI-ProteinID: XP_019812241
UniProt: A0A6P5B5X5
LinkDB
Position
1
AA seq 1259 aa
MSSSKSVSPPGYAAQTAAAPASRGGPEHRSAWGEADSRANGYPQAPGGSARGSTKRPGGA
VTPQQQQRLASRWRSDDEDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQRR
GAAGGGSTRAPPAGSGGGSVXXXXAAGGTEVRPRSVELGLEERRGKGRAADDLEAGAVEE
DEGSGDGGSSAGSGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQSSL
TMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILVMAVLCNRAAFHQDHMGLAC
YALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSALHL
AIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLHSQ
RENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLA
SQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGM
DMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAG
RIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMNRQ
RTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESSNPEDEVDEFLGR
AIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQITI
VPHSVFMLSFYLTCFLLLTLVVFVSVIYSCVKLFPAPLQTLSRKIVRSKMNSTLVGVFTI
TLVFLSAFVNMFTCNSKDLFGCLGDEHNISASQVNACHVVESAVNYSLGDEQGFCGSSWP
NCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLVVEVPGVTLFDNADLLV
TANAIDFNNNGTSQCPEHPTKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKLQA
TEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSE
FYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDK
VGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNT
VNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPPS
NT seq 3780 nt   +upstreamnt  +downstreamnt
atgtccagctccaaaagcgtgagccccccgggctacgcggcgcagacagcggcggcgccg
gcgtcccggggaggcccggaacaccgctccgcgtggggagaggccgactcccgcgccaat
ggctacccccaagcccccgggggttctgcccgcggctccaccaagagacctgggggggcg
gtgaccccgcagcagcaacagcgcctggccagccgctggcgcagcgacgacgaagacgat
cctccgctgagtggcgatgaccccctggccgggggcttcggcttcagcttccgttccaag
tcggcctggcaggagcgcggcggcgacgactgcggtcgcggcagccggcggcagcggcgg
ggcgcggccggcgggggcagcacccgggcgccccctgcgggcagcggcggcggttcggtg
nnnnnnnnnnncgcagcgggcgggacggaagtgcgcccccgttcggtggagctaggcctg
gaggagcggcgtggcaagggccgcgcggccgacgatctggaggccggcgccgtcgaggaa
gacgaagggtccggggatgggggcagctcggcaggctcgggcgcggggcctggcgcggtg
ctgtcgctgggcgcctgctgcctggcactgctgcagatattccgctctaagaagttccca
tcggacaagctggagcggctgtaccagcgctacttcttccgtctgaaccagagcagcctc
acaatgctcatggctgtgctggtgctcgtgtgcctagtcatgttggccttccacgcggca
cggcccccgctgcagctgccctacctggccgtcctagcggccgccgtgggtgtgatcctc
gttatggccgtgctctgcaaccgtgccgccttccaccaggaccacatgggcctggcctgc
tacgcgcttatcgccgtggtgctggccgtccaggtggtgggcctgttgctgccccagccg
cgcagtgcctccgagggcatctggtggactgtgtttttcatctatacgatctacacgctc
ctgcccgtgcgcatgcgggctgcggtactcagcggggtgctcctgtccgccctccacctg
gccatcgccctgcgcaccaacgcccaggatcagttcctgctcaagcagctcgtctccaac
gtcctcattttctcctgcaccaacattgtgggtgtgtgcacccactacccggctgaggtc
tcgcagaggcaggccttccaggagacccgggagtgcatccaggctcggctccactcacag
cgggagaaccagcagcaggagcggctcctgctgtctgtccttccccgtcacgttgccatg
gagatgaaagccgacatcaacgccaaacaggaggatatgatgttccataagatttacatc
cagaaacatgacaacgtgagcattctgtttgctgacatcgagggtttcaccagcctggca
tcccagtgcactgcccaggagctggtcatgaccctcaacgagctcttcgcccgcttcgac
aagctggctgcggagaatcactgtttacgtattaagatcctgggagattgttattactgt
gtctcagggctgcctgaagccagggctgaccacgcccactgctgcgtggagatgggcatg
gacatgatcgaggccatctcgctggtccgggaggtgacaggtgtgaacgtgaacatgcgt
gtgggaattcacagcgggagagtgcactgcggtgtcctcggcctcaggaagtggcagttc
gatgtctggtctaacgatgtcacactggccaaccacatggaggctggaggcaaggcggga
cgcatccacatcaccaaggccactctcaactacttgaatggtgactacgaagtggagcca
ggctgtgggggcgagcgcaacgcctacctcaaggagcacagtatcgagacctttctcatc
ctgcgctgcacccagaagcggaaagaagagaaggccatgattgccaagatgaaccgtcag
agaaccaactccatcgggcacaacccgccccactggggggccgagcgccccttctataac
cacctggggggcaaccaggtgtccaaggagatgaagcggatgggctttgaagaccccaag
gacaagaatgcccaggaaagttcgaaccctgaggatgaagtggatgaatttctgggccgt
gccattgatgccaggagcatcgacaggctgcgatctgaacatgttcgcaagttcctcttg
accttcagggagcctgacttagagaagaagtactccaagcaggtggatgaccgattcggt
gcctacgtggcctgtgcctcgctcgtcttcctcttcatctgctttgtccagatcaccatt
gtgccccactccgtgttcatgttgagtttctacctgacctgtttcctgctgctgaccttg
gtggtgtttgtgtccgtgatctattcttgcgtgaagctcttcccagccccgctgcagacg
ctctccaggaagatcgtgcggtccaagatgaacagcaccctggtgggggtgttcaccatc
accctcgtgttcctgtcggctttcgtcaacatgttcacgtgcaactccaaggacctgttt
ggctgcctgggggacgagcacaacatcagtgccagtcaggtcaatgcatgccacgtggtg
gagtcggccgtcaactacagtctgggtgacgagcagggcttctgcggcagctcctggccc
aactgcaacttccccgagtacttcacctatagcgtgctgctcagcctgctggcctgctcc
gtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatcgagctcatc
tacgtgctcgtcgttgaggtgcccggtgtcacgctctttgacaatgccgacctactggtc
acggccaacgccatagacttcaacaacaacgggacctcccagtgccctgagcatccaacc
aaggtggcgctgaaggtggtgacgcccatcatcatctccgtcttcgtgctggccctgtac
ctgcatgcccagcaggtggagtccactgcccgcctcgacttcctctggaaacttcaggcc
acggaggagaaggaggagatggaggagctgcaggcctacaaccggcggctgctgcacaac
attctgcccaaggacgtggccgcacacttcctggcccgcgaacggcgcaacgacgagctc
tactatcagtcgtgcgagtgcgtggccgtcatgttcgcctccatcgccaacttctctgag
ttctacgtggaactagaggccaacaacgagggcgtcgagtgcctgcggctgctcaacgag
atcatcgcagactttgacgagatcattagtgaggaccggttcaggcagctggaaaagatc
aagaccatcggcagcacctacatggccgcctccggcctcaatgactccacctacgacaag
gtgggcaagacccacatcaaagccctggccgacttcgccatgaagttgatggaccaaatg
aagtacatcaacgagcactctttcaacaacttccagatgaagatcgggctcaatattggc
cccgtggtggcgggtgtgattggagcccgcaagcctcagtacgacatctggggcaatacg
gtgaacgtggccagccgcatggacagcaccggtgtgcccgaccgcatccaggtcaccaca
gacatgtaccaggtgctggccgccaatacgtaccagctggagtgccggggtgtggtcaag
gtcaagggcaaaggcgagatgatgacctacttcctcaacggaggacccccgcccagttag

KEGG   Bos indicus (zebu cattle): 109557525
Entry
109557525         CDS       T04792                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase type 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00230  Purine metabolism
biu01100  Metabolic pathways
biu01522  Endocrine resistance
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04114  Oocyte meiosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04611  Platelet activation
biu04713  Circadian entrainment
biu04714  Thermogenesis
biu04720  Long-term potentiation
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04727  GABAergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04913  Ovarian steroidogenesis
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04921  Oxytocin signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu04976  Bile secretion
biu05032  Morphine addiction
biu05142  Chagas disease
biu05146  Amoebiasis
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109557525 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109557525 (ADCY1)
   04371 Apelin signaling pathway
    109557525 (ADCY1)
   04020 Calcium signaling pathway
    109557525 (ADCY1)
   04072 Phospholipase D signaling pathway
    109557525 (ADCY1)
   04024 cAMP signaling pathway
    109557525 (ADCY1)
   04022 cGMP-PKG signaling pathway
    109557525 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109557525 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109557525 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109557525 (ADCY1)
   04062 Chemokine signaling pathway
    109557525 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    109557525 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    109557525 (ADCY1)
   04912 GnRH signaling pathway
    109557525 (ADCY1)
   04913 Ovarian steroidogenesis
    109557525 (ADCY1)
   04915 Estrogen signaling pathway
    109557525 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    109557525 (ADCY1)
   04921 Oxytocin signaling pathway
    109557525 (ADCY1)
   04926 Relaxin signaling pathway
    109557525 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    109557525 (ADCY1)
   04918 Thyroid hormone synthesis
    109557525 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    109557525 (ADCY1)
   04916 Melanogenesis
    109557525 (ADCY1)
   04925 Aldosterone synthesis and secretion
    109557525 (ADCY1)
   04927 Cortisol synthesis and secretion
    109557525 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109557525 (ADCY1)
   04270 Vascular smooth muscle contraction
    109557525 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    109557525 (ADCY1)
   04971 Gastric acid secretion
    109557525 (ADCY1)
   04972 Pancreatic secretion
    109557525 (ADCY1)
   04976 Bile secretion
    109557525 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    109557525 (ADCY1)
   04727 GABAergic synapse
    109557525 (ADCY1)
   04725 Cholinergic synapse
    109557525 (ADCY1)
   04720 Long-term potentiation
    109557525 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    109557525 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109557525 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    109557525 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    109557525 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109557525 (ADCY1)
   04714 Thermogenesis
    109557525 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109557525 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    109557525 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109557525 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109557525 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109557525 (ADCY1)
   05163 Human cytomegalovirus infection
    109557525 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109557525 (ADCY1)
   05142 Chagas disease
    109557525 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109557525 (ADCY1)
Enzymes [BR:biu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109557525 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 109557525
NCBI-ProteinID: XP_019814464
UniProt: A0A6P5BQU8
LinkDB
Position
4
AA seq 1128 aa
LAVGGGGGGGAGESVGAERRAGPGGRRGLRACDEEFACPELEALFRGYTLRLEQAATLKA
LAXLSLLAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQLQQVGQ
LALLFSLTFALLCCPFALGGPAGAHAGAAAVPATADQGVWQLLLVTFVSYALLPVRSLLA
IGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFLGVNVYGVFVRILAERAQRKAFL
QARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSI
LFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPK
TDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVT
LANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNSFLKTHNIETFFIVPSHRRKI
FPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRTASE
KLRNRSSFSTNVVQTTPGTRVNRYIGRLLEARQMELEMADLNFFTLKYKQAERERKYHQL
QDEYFTSAVVLALILAALFGLVYLLIIPQSVAVLLLLVFCICFLVACVLYLHITRVQCFP
GCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWSXCSSPNGSLVVLSSGGRDPVLPVPPC
ESAPHALLCGLVGTLPLAIFLRVSSLPKMILLAVLTTSYILVLELSGYTKAMGAGAISGR
SFEPIVAILLFSCTLALHARQVDVKLRLDYLWAAQAEEERDDMEKVKLDNKRILFNLLPA
HVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIAD
FDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTKAKKCISSHLSTLADFAIEMFDVLD
EINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEE
VHRLLRRGSYRFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQTRSLNSERKMYPFGRAGLQ
XRLAAGHPPVPPAAGLPVGAGPGALQGSGLAPGPPGQHLPPGASGKEA
NT seq 3387 nt   +upstreamnt  +downstreamnt
ctagcagtcggcggcggaggcggaggcggcgcgggcgagtctgttggcgccgagcggcgg
gcggggccgggcggccggcgcgggctgcgggcgtgcgatgaggagttcgcgtgccccgag
ctggaggcgctgttccgcggctacacgctgcggctggagcaggcggcgacgctgaaggcg
ctggccrtgctcagcctgctggcgggcgcgctggccctggccgagctgctgggcgcgccg
gggcccgcgcccggcctggctaagggctcgcaccccgtgcactgcgtgctcttcctggcg
ctgctcgtggtcaccaacgtccgctcgctgcaggtgccccagctgcagcaggtcggccag
ctcgcgctgctcttcagcctcaccttcgctctgctgtgctgtcccttcgcgctcggcggc
cccgccggtgcccacgccggggcggcagcggtgccggcgacagccgatcagggagtctgg
cagctccttttggtyaccttcgtgtcctatgccctgctgcccgtgcgcagcctgctggcc
atcggcttcgggctcgtggtggccgcctcgcacttgctggtcacggctacgttggtcccc
gccaagcgcccacgtctctggagaacgctgggtgccaacgctctgctcttcctyggtgtg
aacgtgtatggcgtcttcgtgaggatcctggctgagcgcgcccagaggaaggccttcctg
caggcccggaactgcattgaggaccggctgaggctggaggaygagaatgagaagcaggag
cggctgctcatgagcctcctgcctcggaatgttgccatggagatgaaggaggacttcctg
aagccccctgagaggattttccacaagatttacatccagcggcatgacaacgtgagcatc
ctctttgcagacatcgtgggcttcacaggcttggcgtcacagtgcacggcccaggagctg
gtgaaactcctcaaygagctcttygggaagtttgacgagctggccacagagaaccactgc
cgccgcatcaagatcctgggagattgctactactgcgtgtctggcctcactcagcccaag
actgaccacgcccactgctgtgtggagatgggcctggacatgatcgacaccatcacgtcc
gtggctgaggccactgaggtggacttgaacatgcgtgtggggctgcacaccggcagggtc
ctctgcggggtcctgggcctgcgtaagtggcagtatgatgtgtggtccaacgacgtgacc
ctggccaacgtcatggaggctgccggcctgcctgggaaggttcacatcacaaagaccacc
ctggcgtgcctgaatggtgactatgaggtggagccgggacacggacacgagaggaacagt
tttctgaaaactcataacatygagaccttttttattgtgccctcgcatcggcgaaagata
tttccagggctgattctctcagacataaaaccggccaagaggatgaagttcaagaccgtg
tgctacctgctggtgcagctcatgcactgccggaagatgttcaaggccgagatccctttc
tccaacgtcatgacctgtgaggaygacgacaagcggagggcactgagaacagcctcggaa
aaactcagaaaccgctcgtctttctctacaaacgttgtccaaaccacccccggcacacgt
gtcaacaggtacatcggccgcctcctggaagcccgccagatggagctggagatggcagac
ctgaacttcttcaccctgaagtacaagcaagctgagcgagagcgaaagtaccaccagctt
caggacgagtatttcaccagcgccgtggttctggctctcattctggccgccttattcggc
cttgtctaccttctaataatcccacagagtgtggctgtcctgctcctgctggtgttctgc
atctgcttcctggtggcctgtgtcctgtacctacacatcacccgggtccagtgttttcca
gggtgcctgaccatccagatccgcaccgtcttgtgcatcttcatcgtggtcttaatctac
tctgtggcccaaggctgtgtggtgggctgcctgccttggtcctngtgctccagtcccaac
gggtccctggtggtcctgtcttctgggggccgggacccagtgctgcctgtcccgccctgc
gagtctgcgccccatgccctgctgtgcggcctcgtgggcaccctcccgctggccatattc
ctgcgggtctcctccttgccaaaaatgatcctgctcgccgtgctcaccacctcctacatc
ctcgtcctggagctcagcgggtacacgaaggccatgggggccggtgccatctcagggcgc
agcttcgagccgatcgtggccatcctgctattctcgtgcacgctggccctgcacgcccgg
caggtggatgtcaagctgcggctggactacctctgggcggcccaggcagaggaggagcgg
gatgacatggagaaagtgaagctggacaacaagaggattctcttcaacctcctgccagcc
cacgttgcccagcacttcctaatgtccaaccctcgcaacatggacctgtattaccagtca
tactcgcaggtgggggtcatgtttgcatccatccccaacttcaatgacttctacatcgag
ctggatggcaacaacatgggggtggaatgtctacgccttctgaatgagatcatcgctgac
tttgatgagctcatggacaaagacttttacaaggacctagagaagatcaagaccattggg
agcacgtacatggctgctgtggggctggcgcccactgctgggaccaaggctaagaagtgc
atctcctcccacctcagcacgttggcagattttgccatcgagatgtttgatgtcctggat
gagatcaactaccagtcttataacgactttgtgctccgtgttggcatcaacgttggcccc
gtggtggctggagtgatcggggctcgcaggccgcagtatgacatttgggggaacacggtc
aatgtggccagtcggatggacagtaccggcgtccagggcaggatccaggtcacagaggaa
gttcaccggctgctgcggcggggttcctaccgcttcgtgtgccgaggcaaagtcagtgtc
aagggcaagggtgagatgctgacatacttcctggaaggcaggaccgatggaaatggctcc
caaaccaggtccctgaactcagagcggaaaatgtatcctttcggaagagctggcctccag
ascagactggctgcgggtcaccccccggtacctcctgcagccggcctcccagttggagct
gggccaggggctctgcagggctcggggcttgccccaggccccccaggccaacacctgccc
cctggagcctctgggaaggaggcttag

KEGG   Bos indicus (zebu cattle): 109559159
Entry
109559159         CDS       T04792                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6 isoform X1
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00230  Purine metabolism
biu01100  Metabolic pathways
biu01522  Endocrine resistance
biu04015  Rap1 signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04114  Oocyte meiosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04611  Platelet activation
biu04713  Circadian entrainment
biu04714  Thermogenesis
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04727  GABAergic synapse
biu04742  Taste transduction
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04913  Ovarian steroidogenesis
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04921  Oxytocin signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04924  Renin secretion
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04961  Endocrine and other factor-regulated calcium reabsorption
biu04962  Vasopressin-regulated water reabsorption
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu04976  Bile secretion
biu05032  Morphine addiction
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109559159 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109559159 (ADCY6)
   04371 Apelin signaling pathway
    109559159 (ADCY6)
   04072 Phospholipase D signaling pathway
    109559159 (ADCY6)
   04024 cAMP signaling pathway
    109559159 (ADCY6)
   04022 cGMP-PKG signaling pathway
    109559159 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109559159 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109559159 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109559159 (ADCY6)
   04062 Chemokine signaling pathway
    109559159 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    109559159 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    109559159 (ADCY6)
   04912 GnRH signaling pathway
    109559159 (ADCY6)
   04913 Ovarian steroidogenesis
    109559159 (ADCY6)
   04915 Estrogen signaling pathway
    109559159 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    109559159 (ADCY6)
   04921 Oxytocin signaling pathway
    109559159 (ADCY6)
   04926 Relaxin signaling pathway
    109559159 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    109559159 (ADCY6)
   04918 Thyroid hormone synthesis
    109559159 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    109559159 (ADCY6)
   04916 Melanogenesis
    109559159 (ADCY6)
   04924 Renin secretion
    109559159 (ADCY6)
   04925 Aldosterone synthesis and secretion
    109559159 (ADCY6)
   04927 Cortisol synthesis and secretion
    109559159 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109559159 (ADCY6)
   04270 Vascular smooth muscle contraction
    109559159 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    109559159 (ADCY6)
   04971 Gastric acid secretion
    109559159 (ADCY6)
   04972 Pancreatic secretion
    109559159 (ADCY6)
   04976 Bile secretion
    109559159 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109559159 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109559159 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    109559159 (ADCY6)
   04727 GABAergic synapse
    109559159 (ADCY6)
   04725 Cholinergic synapse
    109559159 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    109559159 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    109559159 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    109559159 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    109559159 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    109559159 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109559159 (ADCY6)
   04714 Thermogenesis
    109559159 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559159 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    109559159 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109559159 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109559159 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109559159 (ADCY6)
   05163 Human cytomegalovirus infection
    109559159 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109559159 (ADCY6)
Enzymes [BR:biu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109559159 (ADCY6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 109559159
NCBI-ProteinID: XP_019816241
UniProt: A0A6P5BFX5
LinkDB
Position
5
AA seq 1166 aa
MSWFSGLLVPKVDERKTAWGERNGQQRPRRGTRTSGFCTPRYMSCLQGAQPPSPTPATAP
RCPWQDEAFIRRGGPGKGPELGLRAVALGFEDPEVAGAVGAAEVAPAVATRSRRACWRQL
VQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAALVLLTXVLLAFHAAPARPQPAYVA
LLACAATLFVALMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLWCP
VFFVYITYTLLPIRMRAAVFSGLGLSTLHLVLAWQLNRGDAFLWKQLGANMLLFLCTNVI
GICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQHIETFLILGASQKRKEEKAMLAKLQRARANSMEGLMPRWVPDRAFSRTKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQLVVFPRSALMLGIHASIFLLLLVTVLTCAVYSCGS
LFPEALQRVSRSIVRSRAHSTAVGIFSVLLVFTSAVASMFTCNHTPLRTCAARMLNLTPA
DITACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFIGNVLLSLLASSVFLHISSIGKLAMI
FVLGLVYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPRS
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtcgtggtttagcggcctcttggtccccaaggtggatgaacggaaaacagcctggggg
gagcgcaatgggcagcagcggccgcgccgtgggacccgcaccagtggcttctgcacgccc
cgctacatgagctgcctccagggtgcgcagccacccagtccgacgcccgccactgcccct
cggtgcccctggcaggatgaggccttcatccggagggggggcccaggcaagggcccggag
ctggggctgcgggcggtggccctgggcttcgaggaccctgaggtggccggggctgtcgga
gcagcggaggtggcgcctgccgtggctaccaggagcaggcgggcctgctggcggcagctg
gtgcaggtgttccagtcgaagcagttccgctcggccaagctggagcgcctgtaccagcgc
tacttcttccagatgaaccagagcagcctgacgctgctcatggcggcgctcgtgctgctc
acnnncgtgctgctggccttccacgcagcgcctgcccgccctcagcccgcctacgtggcc
ctgctggcctgtgccgccaccctcttcgtggcactcatggtggtgtgcaaccggcacagc
ttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcggccgtg
caggtcgggggcgccctggcagccgacccgcgtagtccctctgcaggcctctggtgccct
gtgttctttgtctacatcacctacacactccttcccatccgtatgcgggctgcagtcttc
agcggcctgggcctctccaccctgcacttggtcttggcctggcagctcaaccgtggtgac
gccttcctctggaagcagcttggagccaacatgctgctgttcctctgcaccaatgtcatt
ggcatctgcacacactatccggctgaggtgtctcagcgccaggcatttcaagagacccgc
ggttacatccaggcccggctgcacctgcagcatgagaaccggcagcaggagcggctgctg
ctgtctgtgttgccccagcatgttgccatggagatgaaagaagacatcaacacaaagaaa
gaagacatgatgtttcataagatctacatccagaagcacgacaatgtcagcatcctgttt
gcggacattgaaggcttcaccagcctggcgtcccagtgcacagcgcaggagctggtcatg
accctgaacgagctctttgcccggttcgacaagctggctgcggaaaatcactgcctgagg
atcaagatcttaggggactgttactactgcgtgtcagggctgccagaggcccgggcagac
catgcccactgctgcgtggagatgggggtggacatgatcgaggctatctcgctggtgcgc
gaggtgacaggtgtaaacgtgaacatgcgcgtgggcatccacagcgggcgtgtgcactgt
ggcgtccttggcttgcggaaatggcagtttgatgtgtggtccaatgacgtgactctggcc
aaccacatggaggccgggggccgggccggccgcatccacatcacccgggccacgctgcag
tacctgaatggggactacgaagtggagccgggccgcggtggggagcgcaacgcctacctc
aaggagcagcacattgagaccttcctcatcctgggagccagccagaaacggaaagaagag
aaggccatgctggccaagctgcagcgggcacgggccaactccatggaagggctgatgcca
cgctgggtgcctgaccgtgccttctcccggaccaaggactccaaggctttccgccagatg
ggcatcgatgattccagcaaagacaaccggggtgctcaggatgccctgaaccctgaggat
gaggtagacgagttcctgggccgggccattgatgcccgcagcattgatcagctgcgcaag
gaccatgtgcgccggttcctgctcaccttccagagagaggatcttgaaaagaagtactca
cgcaaggtggacccccgctttggagcctacgtggcctgtgccctgctggtcttctgcttc
atctgcttcatccagcttgttgtcttcccacgctcagctctgatgcttgggatccacgcc
agtatcttcctgctgttactggtcaccgtgctgacttgtgccgtgtactcctgtggctct
ctgttccctgaggccctgcaacgtgtatctcgcagtatcgtccgctcgagggcacatagc
accgcagttggcatcttttctgtcctgcttgtgttcacctccgccgttgccagcatgttc
acctgtaaccacacccccttacgaacttgcgcagcccggatgctgaatttaacccctgct
gacattaccgcctgccacctgcagcagctcaattactctctgggcctggatgctcccctg
tgtgagggcaccgcacccacctgcagcttccctgagtacttcattgggaacgtgttgctg
agtctcttggccagctctgtcttcctgcacatcagtagtatcgggaagttggccatgatc
tttgtcctggggctcgtttatctggtgctgcttctgctgggtcccccagccaccatcttt
gacaactatgacctcctgctgggcgtccacggcttggcttcttccaatgagacctttgat
gggctggactgcccagcggccgggagggtggcactcaaatacatgacccccgtgattctg
ctggtgtttgcactggcgctgtacctgcatgcccagcaggtggagtccaccgcccgcctg
gacttcctctggaagctgcaggcaacaggggagaaggaagagatggaggagctccaggcc
tacaaccggcggctgctacataacattctgcccaaggacgtggccgcccacttcctggcc
cgggagcgccggaacgacgagctctactatcagtcctgtgaatgtgtggccgtcatgttt
gcctccattgccaacttctctgagttctacgtggagctggaggccaacaacgagggtgtt
gagtgcctgcgactgctcaatgagatcattgctgatttcgatgagatcatcagtgaggag
cgcttccggcagctggagaagatcaagacaattggtagcacctacatggctgcctctggg
ctgaacgccagcacctatgatcaggtgggccgctcccacatcactgccctcgccgactat
gccatgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaatttccag
atgaagatcggactgaacatgggcccagttgtggcaggcgtcattggggctcggaagcca
cagtatgacatctgggggaacacagtgaatgtctcgagtcgaatggacagcaccggggtc
cctgaccgaatccaggtgaccacggacctgtaccaggttctagcggccaagggctaccag
ctggaatgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctc
aatgggggccccaggagttag

KEGG   Bos indicus (zebu cattle): 109564199
Entry
109564199         CDS       T04792                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00230  Purine metabolism
biu01100  Metabolic pathways
biu01522  Endocrine resistance
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04114  Oocyte meiosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04611  Platelet activation
biu04713  Circadian entrainment
biu04714  Thermogenesis
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04727  GABAergic synapse
biu04742  Taste transduction
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04913  Ovarian steroidogenesis
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04921  Oxytocin signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu04976  Bile secretion
biu05032  Morphine addiction
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109564199 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109564199 (ADCY4)
   04371 Apelin signaling pathway
    109564199 (ADCY4)
   04020 Calcium signaling pathway
    109564199 (ADCY4)
   04072 Phospholipase D signaling pathway
    109564199 (ADCY4)
   04024 cAMP signaling pathway
    109564199 (ADCY4)
   04022 cGMP-PKG signaling pathway
    109564199 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109564199 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109564199 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109564199 (ADCY4)
   04062 Chemokine signaling pathway
    109564199 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    109564199 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    109564199 (ADCY4)
   04912 GnRH signaling pathway
    109564199 (ADCY4)
   04913 Ovarian steroidogenesis
    109564199 (ADCY4)
   04915 Estrogen signaling pathway
    109564199 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    109564199 (ADCY4)
   04921 Oxytocin signaling pathway
    109564199 (ADCY4)
   04926 Relaxin signaling pathway
    109564199 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    109564199 (ADCY4)
   04918 Thyroid hormone synthesis
    109564199 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    109564199 (ADCY4)
   04916 Melanogenesis
    109564199 (ADCY4)
   04925 Aldosterone synthesis and secretion
    109564199 (ADCY4)
   04927 Cortisol synthesis and secretion
    109564199 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109564199 (ADCY4)
   04270 Vascular smooth muscle contraction
    109564199 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    109564199 (ADCY4)
   04971 Gastric acid secretion
    109564199 (ADCY4)
   04972 Pancreatic secretion
    109564199 (ADCY4)
   04976 Bile secretion
    109564199 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    109564199 (ADCY4)
   04727 GABAergic synapse
    109564199 (ADCY4)
   04725 Cholinergic synapse
    109564199 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    109564199 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    109564199 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    109564199 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    109564199 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    109564199 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109564199 (ADCY4)
   04714 Thermogenesis
    109564199 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109564199 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    109564199 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109564199 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109564199 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109564199 (ADCY4)
   05163 Human cytomegalovirus infection
    109564199 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109564199 (ADCY4)
Enzymes [BR:biu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109564199 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 109564199
NCBI-ProteinID: XP_019823303
UniProt: A0A6P5CCY5
LinkDB
Position
10
AA seq 1039 aa
MARLFSPRQPPSEDLFYETYYSLSQQYPLLLLLLLIVLLGLLALLPVAWASGRELAADPA
FLTTVLCALGGFSLLLVLASREQRLQRWTRPLSGLVWAALLALGHSFLFTGGVVSAWDQV
SFFLFVIFTVYAMLPLDMRDAITAGVTSSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNAAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
EEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEASGVPGCPHMAQAAEEDEKG
TAGGLLSSLEGSKMRPSLLMTRYLESWGAAKPFAHLSHVESPVSTSTPLPEKALSSFSPQ
WSLDRSRTMRGPDEELDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRL
SALPAFKYYAACTFLVFLSNFIIQMLVTNRPPALTITYGITFLLFFLLLFVCFSEHLMKC
VLKGPKMLHWLPTLSVLVATRPGLRVALGTATILLVFVMAITSLVFLPATSACPFQAPNM
SSMASNLSWELPGSLPLISIPYSMHCCVLGFLSCSLFLHMSFELKLLLLLLWLTASCSIF
LHSHAWLSDCLIARLYLGTLDSRPGVLKEPKLMGAVSFFIFFFTLLVLARQNEYYCRLDF
LWKKKLRQEQEETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFAS
VPDFKEFYSESSINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTICSTYMAATGLN
ATSGQDAQQDAEQSCGHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIG
AQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETAWALQSLGYTCYSRGIIKVKGKGQLC
TYFLNTDLTRTGPPSATLG
NT seq 3120 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccacggcagccccccagcgaagacctcttctacgagacctac
tacagcttgagccagcagtacccactgctgctgctgctgctgctgatcgtgctcttgggg
ctcctggcgctgctccctgtggcctgggcaagtggcagggagctggccgcagacccagcc
ttcctgaccactgtgctgtgcgctctgggtggcttctcactgctgctggtcctggcttcc
cgggagcagcgactgcagcgctggacgcgtcccctgtcaggcctcgtgtgggcagcactg
cttgcactaggccacagcttcctgttcactgggggcgtggtgagcgcctgggaccaggtg
tcctttttcctttttgtcatcttcactgtgtatgccatgttgcccttggacatgcgggac
gccatcaccgcgggtgtcacctcctcactctcacacttgctggtccttgggctgtatctt
gggcctcagcccgactctcggccggcgctgctgccacagctggctgcaaacgcggtgctg
ttcctgtgcgggaacgcggccggagcctatcacaaggcgctgatggagcgcgcgctgcgc
gccacgttccgggaggcgcttagttccctgcactcgcggcggagactggacaccgagaag
aagcatcaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaag
gaggagatcatggcacggctgcaggctggacaggggtcacggccagagagcaccaacaac
tttcacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgagactggccagtgagtgctcccctaaggagttggtgcttatgctcaacgag
ctctttggcaagttcgaccaaatcgccaaggagcacgaatgcatgcggatcaagatccta
ggagactgttactactgtgtctccggcctgccgctctcactgcctgaccacgccatcaac
tgtgtgcgcatggggctggacatgtgccgggccatcaggaaacttcgggcagccacaggc
gtggatatcaacatgcgtgtgggcgtgcactcaggcagcgtgctctgcggggtcatcggg
ctacagaaatggcagtatgatgtctggtcccatgacgtcactctggccaaccacatggag
gcgagtggagtgccagggtgccctcatatggcccaggctgcagaggaggacgagaagggt
actgcaggagggttgctgtcctctcttgagggctccaagatgcgtccatcactgctgatg
acccgctacctggagtcctggggtgcagccaagcctttcgcccacctgagccacgtagag
agccctgtgtccacatctacccctctcccggagaaggccctgtcttccttcagcccccag
tggagcctggaccggagccgtaccatgaggggacctgatgaggaattagacactggggat
gccaagttcttccaggtcatcgaacagctcaattctcagaaacaatggaaacagtcaaag
gacttcaatccactgacactgtacttcagagagaaggagatggagaaagagtatcggctc
tctgcactccccgccttcaaatactatgcagcctgcaccttcctggtttttctctccaac
ttcattatccagatgctggtgacaaacaggcctccagctctgaccatcacctatggcatc
accttcctcctcttcttcctcctcctcttcgtctgcttctcagagcacctgatgaagtgt
gtcttgaaaggccccaagatgctgcactggctacccaccctgtctgtcctggtggccaca
cggccaggactgcgagtggctctgggcaccgctaccatcctgctcgtcttcgtcatggcc
attaccagtctggtcttcttaccagcaacatcagcctgcccttttcaggctcccaatatg
tcctccatggcttccaacctctcctgggagctccctgggtccctgcctctcatcagcatc
ccatactccatgcactgctgcgtgttgggcttcctctcctgctccctcttcctgcacatg
agctttgagctgaagctgctgctgctcctgctgtggctgacggcctcctgctccatcttc
ctgcactcccacgcctggttgtccgactgcctcatcgcccgcctctacctgggcaccttg
gactccaggccaggggtgctgaaggagcccaaactgatgggagcagtctccttcttcatc
ttcttcttcaccctcctagtcctggctcggcagaacgaatattactgccgcctggacttt
ctgtggaagaagaagctgaggcaagagcaggaggagacagagacaatggagaacctgact
cggctgctcttggagaacgtgctccctgcgcacgtggccccccagttcattggtcagaat
cggcgcaatgaggacctctaccaccagtcctatgagtgtgtgtgtgtcctcttcgcctcg
gtcccagacttcaaggagttctactctgaatccagcatcaaccatgaggggctagagtgt
ctgcggctgctcaatgagataatcgctgattttgatgagctgctctccaagcccaagttc
agtggggtggagaagatcaaaactatctgcagcacctacatggcagctaccggcttgaac
gccacctctggacaggatgcacagcaggatgctgagcaaagctgcggccaccttggcacc
atggtagagtttgctgtggcccttgggtctaagctggatgtcatcaacaagcactcattc
aacaactttcgcttgcgtgtagggttaaaccacggacctgtagtggctggagtgattggg
gcccagaaaccacaatatgacatctggggcaacacggtgaatgtggccagccgcatggag
agcacaggtgtcctgggcaagattcaggtaacagaagagacagcctgggccctccagtcc
ttaggctacacctgctacagccggggcatcatcaaggtcaaaggcaaagggcagctctgc
acctacttcttgaacacagatttgacacgaactggacctccctcagccaccctaggctga

KEGG   Bos indicus (zebu cattle): 109566330
Entry
109566330         CDS       T04792                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00230  Purine metabolism
biu01100  Metabolic pathways
biu01522  Endocrine resistance
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04114  Oocyte meiosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04611  Platelet activation
biu04713  Circadian entrainment
biu04714  Thermogenesis
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04727  GABAergic synapse
biu04740  Olfactory transduction
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04913  Ovarian steroidogenesis
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04921  Oxytocin signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04962  Vasopressin-regulated water reabsorption
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu04976  Bile secretion
biu05032  Morphine addiction
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109566330 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109566330 (ADCY3)
   04371 Apelin signaling pathway
    109566330 (ADCY3)
   04020 Calcium signaling pathway
    109566330 (ADCY3)
   04072 Phospholipase D signaling pathway
    109566330 (ADCY3)
   04024 cAMP signaling pathway
    109566330 (ADCY3)
   04022 cGMP-PKG signaling pathway
    109566330 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109566330 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109566330 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109566330 (ADCY3)
   04062 Chemokine signaling pathway
    109566330 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    109566330 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    109566330 (ADCY3)
   04912 GnRH signaling pathway
    109566330 (ADCY3)
   04913 Ovarian steroidogenesis
    109566330 (ADCY3)
   04915 Estrogen signaling pathway
    109566330 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    109566330 (ADCY3)
   04921 Oxytocin signaling pathway
    109566330 (ADCY3)
   04926 Relaxin signaling pathway
    109566330 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    109566330 (ADCY3)
   04918 Thyroid hormone synthesis
    109566330 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    109566330 (ADCY3)
   04916 Melanogenesis
    109566330 (ADCY3)
   04925 Aldosterone synthesis and secretion
    109566330 (ADCY3)
   04927 Cortisol synthesis and secretion
    109566330 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109566330 (ADCY3)
   04270 Vascular smooth muscle contraction
    109566330 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    109566330 (ADCY3)
   04971 Gastric acid secretion
    109566330 (ADCY3)
   04972 Pancreatic secretion
    109566330 (ADCY3)
   04976 Bile secretion
    109566330 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109566330 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    109566330 (ADCY3)
   04727 GABAergic synapse
    109566330 (ADCY3)
   04725 Cholinergic synapse
    109566330 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    109566330 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    109566330 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    109566330 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    109566330 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    109566330 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109566330 (ADCY3)
   04714 Thermogenesis
    109566330 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109566330 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    109566330 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109566330 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109566330 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109566330 (ADCY3)
   05163 Human cytomegalovirus infection
    109566330 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109566330 (ADCY3)
Enzymes [BR:biu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109566330 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 109566330
NCBI-ProteinID: XP_019826170
UniProt: A0A6P5CKI9
LinkDB
Position
11
AA seq 1145 aa
MPRTQGFSEPEYSAXXXAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLXRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSGDKLAPLAVAGVGLVLDII
LFVLCKKGLLPNRVTRRVVPYLLWLLISAQVFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGVQLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGEGGSRCD
YLEEKGIETYLIIASKPEVKKTAAQNGLNGSALLNGAPPSSKPSSPALIETKESNGSIHT
SGSISEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTAVVEILIDPWLMTN
YVTFVVGEALLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPTNGTAEMQVEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLIAGAVAVINIYAWCPIFDDYDRKRFQQHDFPMVALEKMQVFSSSGLNGTDRLPLVPSK
YSMTVMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKDEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGASITLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctccgagccygagtactccgcggnnnnnncggccgagtac
tctgtcagcctgccttcggacccggaccgcggggtgggccggacccatgaaatctctgtc
cggaactcggggtcgtgcctctgcttgcstcgcttcatgcggctgaccttcgtaccagag
tccttggagaacctgtaccagacctacttcaagaggcagcgccacgagaccctgctggtg
ctggtggtcttcgcggccctcttcgactgctatgtggtggtcatgtgcgctgtggtcttc
tctggcgacaagctggcccccctggccgtggctggggtcgggctggtgttggacatcatc
cttttcgtgctctgcaaaaaggggctgctccccaaccgggtcactcggagagtggtgccc
tacctgctgtggctgctgatatcagcccaggtcttctcctacctgggcctgaacttctcc
cgtgcccaygcggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcacgctgccgctcagcctcagccccattgtcatcatctccgtggtctcctgcgtcgtg
cacacactcgtcttgggggtcactgtggcccagcarcagcaggatgggctgaagggagtg
cagttgctgagggagattctggccaacgtcttcctctacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tctctggaggtgaagatgaacctggaggagcagagtcagcagcaggagaaccttatgctc
tccatcctgcccaagcacgtggccgacgagatgctgaaggacatgaagaaggatgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgctgatatcgtgggcttcacccagctgtcctcagcctgcagcgcccaggagctt
gtgaagctgctcaatgagctctttgcccgcttcgacaagctggcggctaaataccaccag
ctgcggattaagatcctgggcgactgttactactgcatctgtgggctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgggagaagacgaagaccggggtggacatgcgcgtgggggtgcacacgggcaccgtg
ctggggggcgtcctyggccagaaacgctggcagtacgacgtgtggtccaccgacgtcacc
gtggccaacaagatggaggctggcggcatccctgggcgtgtgcacatctcccagagcacc
atggactgcctgaaaggagagttcgacgtggagccgggcgaggggggcagtcgctgtgat
tacctggaagagaagggcattgagacctacctcatcatcgcttccaagccagaggtgaag
aagacagctgcccaaaatggcctcaacggctcggccctgctgaacggagcgccgccktcc
tcaaagcccagctcccctgccctcattgagaccaaggagtccaacgggagcattcacacc
agcggctctatatctgaggagccygaggagcaagatgcccaggccgacaacccctcgttc
cccaaccctcgccggaggctgcgccttcaggacctggctgatcgcgtggtggacgcctcc
gaggacgagcatgagctcaaccagctactcaacgaggcgctgctagagcgggagtctgcc
cargtagtgaagaagagaaacaccttcctcctgtccatgcggttcatggaccccgagatg
gaaacccgctactcggtggagaaggagaagcaragcggggctgccttcagctgctcctgc
gttgtcctactctgcacggccgtggtggagatcctcattgacccctggctcatgacgaac
tatgtgacctttgtggttggggaggctctgctcctgatcctgacaatctgctcgctggct
gccatctttccgcgggcctttcctaagaagctcgtggccttctctacttggattgaccgg
acgcgctgggccaggaacacctgggccatgctggccatcttcattcttgtcatggcaaac
gtggtggacatgctcagctgtctccagtactacacaggacccaccaacggcaccgcagag
atgcaggtggaggatggctgcgtggagaaccccaagtattacaactacgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtcaagctcacactcatg
ctgctcatcgcgggggccgtggctgtcatcaacatctacgcctggtgccccatctttgac
gactacgaccgcaaacgcttccagcaacacgactttccgatggtggccttagagaagatg
caggtgttttccagctcggggctcaatggcactgacaggctgcccctggtgccgtctaag
tactcgatgacagtgatgatctttgtcatgatgctgagcttttactacttctcccgccac
gtggaaaagctggcacggacactgttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaatgaagccttggtcaccaacatgctacctgaacac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttat
gatgagattggagttatgtttgcctccctgcccaattttgctgacttctacacagaggag
agcatcaataacggtggcattgagtgtctacgcttcctcaatgagatcatctcagatttt
gactctcttctggacaatcccaagttccgggtcatcaccaagatcaagaccattggtagc
acctacatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagctcc
aacaaggacgagaagtcagacaaggagcgctggcagcacctggcagatctggccgatttt
gcgctggccatgaaggacacgctcaccaacatcaacaaccagtccttcaacaacttcatg
ctgcgcattggaatgaacaaaggaggggtcctggctggggtcattggagcccggaaacca
cactatgacatctggggcaacacagtcaacgtagccagcaggatggagtccacaggggtc
atgggcaacatccaggtggtggaagaaacccaagtcatccttcgagaatacggcttccgc
ttcgtgaggagagggcccatctttgtgaaagggaagggggaactgctaacctttttcttg
aagggccgagacaagctggccacattccctaacggcgcctcaatcacactgcctcaccag
gtggtagacaactcctga

KEGG   Bos indicus (zebu cattle): 109568647
Entry
109568647         CDS       T04792                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase type 8 isoform X1
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00230  Purine metabolism
biu01100  Metabolic pathways
biu01522  Endocrine resistance
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04114  Oocyte meiosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04611  Platelet activation
biu04713  Circadian entrainment
biu04714  Thermogenesis
biu04720  Long-term potentiation
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04727  GABAergic synapse
biu04742  Taste transduction
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04913  Ovarian steroidogenesis
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04921  Oxytocin signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu04976  Bile secretion
biu05032  Morphine addiction
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109568647 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109568647 (ADCY8)
   04371 Apelin signaling pathway
    109568647 (ADCY8)
   04020 Calcium signaling pathway
    109568647 (ADCY8)
   04072 Phospholipase D signaling pathway
    109568647 (ADCY8)
   04024 cAMP signaling pathway
    109568647 (ADCY8)
   04022 cGMP-PKG signaling pathway
    109568647 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109568647 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109568647 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109568647 (ADCY8)
   04062 Chemokine signaling pathway
    109568647 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    109568647 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    109568647 (ADCY8)
   04912 GnRH signaling pathway
    109568647 (ADCY8)
   04913 Ovarian steroidogenesis
    109568647 (ADCY8)
   04915 Estrogen signaling pathway
    109568647 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    109568647 (ADCY8)
   04921 Oxytocin signaling pathway
    109568647 (ADCY8)
   04926 Relaxin signaling pathway
    109568647 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    109568647 (ADCY8)
   04918 Thyroid hormone synthesis
    109568647 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    109568647 (ADCY8)
   04916 Melanogenesis
    109568647 (ADCY8)
   04925 Aldosterone synthesis and secretion
    109568647 (ADCY8)
   04927 Cortisol synthesis and secretion
    109568647 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109568647 (ADCY8)
   04270 Vascular smooth muscle contraction
    109568647 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    109568647 (ADCY8)
   04971 Gastric acid secretion
    109568647 (ADCY8)
   04972 Pancreatic secretion
    109568647 (ADCY8)
   04976 Bile secretion
    109568647 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    109568647 (ADCY8)
   04727 GABAergic synapse
    109568647 (ADCY8)
   04725 Cholinergic synapse
    109568647 (ADCY8)
   04720 Long-term potentiation
    109568647 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    109568647 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    109568647 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    109568647 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    109568647 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    109568647 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109568647 (ADCY8)
   04714 Thermogenesis
    109568647 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109568647 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    109568647 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109568647 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109568647 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109568647 (ADCY8)
   05163 Human cytomegalovirus infection
    109568647 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109568647 (ADCY8)
Enzymes [BR:biu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109568647 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 109568647
NCBI-ProteinID: XP_019829623
UniProt: A0A6P5CVG6
LinkDB
Position
14
AA seq 1253 aa
MELSDVRCLSGSEELYTIHPTPPAGDSGSGSRPQRLLWQTAVRHITEQRFIHGHRGGGGG
GGNGSSSKASDPGGGGPNHHHASQLSGDSALPLYALGPGERAHGTGGPKVFPERSGSGSA
SGSGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQR
RKSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTS
HTYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLG
TSLMQVVLQAVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVE
ARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFA
DVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDH
AHCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIAN
KLESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLSLP
EDIVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQAL
HVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVC
AFIVLLFITAIQSLLPSSRVMPMAIQFSILIMLHSALVLITTAEDYKCLPLVLRKTCCWI
NETYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVF
TGVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLRYDNLNHSGEDFLGTK
EASLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSH
VARHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADF
DELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEIN
KHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYL
ILKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLG
LVQSLNRQRQKQLLNENNNTGIIKGHYNRRTLLTPSGPEPGAPAEGADKPELP
NT seq 3762 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgcctgagcggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacagcgggagcggctcccggccgcagcggctgctgtggcagacg
gcggtgcggcacatcaccgagcagcgcttcatccatgggcaccgcggcggcggcggcggt
ggcgggaacggaagctccagcaaagcctcggaccccggaggcggcggacccaaccaccac
cacgcgtcgcagctgtccggcgactcggcgctgcccctctacgcgctgggccctggggag
cgagcgcacggcaccggcggccccaaagtcttcccggaacgcagcgggagcggcagcgcc
agcggcagcggcggcgggggagacctgggcttcctgcacctcgactgcgccccgagcaac
tcggatttcttcctcaatgggggctacagctaccgaggggtcattttccccaccctgcgc
aactccttcaagtcccgggatctggagcgcctctaccagcgctatttcctgggccagagg
cgcaaatcggaggtggtgatgaacgtgctggacgtgctgaccaaactcaccctcctggtt
ctccacttgagcctggcctcggcccccatggacccgctcaagggcatcctgctgggcttc
ttcaccggcatagaggtggtgatctgcgccctggtggtggtcagaaaggacaccacctcg
cacacatacctgcagtacagcggtgtggtcacttgggtggccatgaccacccagatctta
gcagcagggctcggctatgggctcctgggagacggcatcggctacgtgctsttcaccctt
tttgccacstacagcatgctgccgctgccgctcacctgggccatcctggccggcctaggc
acctctttgatgcaggtggtcctccaagcggtcatccccaggctggcggtcatttccatc
aatcaggttgtggcccaggcagtgttattcatgtgtatgaacacagctggaatcttcatc
agttacctgtcagaccgggcccagcgccaggccttcctggagacacggaggtgtgtggag
gccaggctgcgcctggagacggaaaaccaaagacaggagcgacttgtgctgtccgtgctt
ccycgttttgttgtcctggagatgatcaatgacatgaccaacgtggaagacgagcaccta
cagcatcagttccaccggatctacatccatcgctacgagaatgtcagtattctttttgca
gatgttaaaggatttaccaacctctccacgaccttgtctgctcaggagctggtcaggatg
ctcaacgagctctttgccagatttgatcgactggcccatgagcatcactgccttcgtatt
aaaatcctgggggactgctactactgcgtttcaggacttcctgagccccgccaggaccac
gcccactgctgtgttgaaatgggcctcagcatgatcaaaactatcaggtatgtgcgatca
aggacaaagcacgatgttgacatgcggattggaatccactcgggctcggtgctgtgcggt
gtgttgggtcttcggaagtggcagtttgatgtctggtcttgggatgtggacatcgcgaac
aaacttgaatctggaggaatccccgggcggattcacatttccaaggccacgctggactgc
ctcaacggtgactataatgtggaagagggtcacggtaaagagaggaatgaattcttgagg
aagcataatatagagacctatttaattaagcagcctgaggagagtctgctgtctttgccc
gaagacatcgtcaaggagtctgtgagctcctcagacaggagaaacagcggggcgacgttc
acagagggatcttggagccctgaattgcccttcgataacatagtggggaaacagaacact
ctggctgccctaacaagaaattcaataaatctacttccaaaccatcttgcacaagctttg
catgtccagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcgg
agtggtgataaattgagaagagagcatatcaagccattctcactgatgtttaaagactcc
agcctggagcacaagtattctcaaatgagggatgaagtattcaaatcaaacttggtctgt
gcgtttatcgttcttctatttatcacggcaatacaaagcttgcttccttcttcaagggtg
atgcccatggccatccagttttccatcctgatcatgctgcactcagctctggtcctcatc
actacggcagaggattacaagtgtttgcccctggtcctccggaaaacctgctgttggatt
aacgagacctatttggccaggaacgtcatcatctttgcatccatcttgattaatttcctg
ggcgccatcctaaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctg
actttcaattcctcagctgtgtttacagatatctgctcctacccagagtactttgtcttc
acgggggtgctggccatggtgacctgtgcggttttcctccgactcaactctgtccttaag
ctggctgtgctcctgatcatgattgccatctacgccctgctgaccgagaccatctatgca
ggcctcttcctgcgctacgacaacctgaaccacagcggagaagatttcctggggaccaag
gaagcgtcactgctgctaatggccatgtttcttcttgccgttttctaccatggacagcag
ctggagtacacagcccgcctggacttcctgtggcgagtccaggccaaagaggagatcaac
gagatgaaagagctgagggagcacaatgagaacatgctgcggaacatcctgcccagccac
gtggcccgccacttcctggagaaggaccgggacaatgaggagctgtattctcaatcctat
gacgccgtcggggtgatgtttgcctccatcccggggtttgcagacttttactctcagacc
gaaatgaacaaccaaggagtggagtgcctccgcctactgaatgagatcattgctgacttc
gatgagctgctcggtgaagaccggtttcaagacattgaaaagattaagaccattggtagt
acctacatggccgtgtcaggcctgtcacctgaaaagcagcaatgcgaggataagtggggg
catttgtgcgccctggccgacttctccctcgccctgactgaaagcatccaggagatcaac
aagcattccttcaacaatttcgagctccggattggcatcagccacggctcagtggtagcc
ggtgtcatcggcgctaagaaaccacagtacgacatttggggcaaaaccgtgaacctggcg
agtcggatggacagcacaggggtcagcggcaggatccaggtcccggaggagacctacctc
atcctgaaggaccagggctttgcctttgactaccgaggggagatctatgtgaagggcatc
agcgaacaggaagggaaaatcaaaacgtactttctcctgggaagagtccagcccaacccc
ttcatcctgccccccaggagactgcccggacagtactccttggccgcggtcgtcctgggc
ctcgtccagtccctcaacaggcagaggcagaagcagctgctgaacgagaacaacaacacg
ggcattatcaagggccactacaaccggcggactttgctgacgcccagcgggcccgagccg
ggagccccagccgaaggcgccgacaagcccgagttgccataa

KEGG   Bos indicus (zebu cattle): 109572478
Entry
109572478         CDS       T04792                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase type 7 isoform X1
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00230  Purine metabolism
biu01100  Metabolic pathways
biu01522  Endocrine resistance
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04114  Oocyte meiosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04611  Platelet activation
biu04713  Circadian entrainment
biu04714  Thermogenesis
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04727  GABAergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04913  Ovarian steroidogenesis
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04921  Oxytocin signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu04976  Bile secretion
biu05032  Morphine addiction
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109572478 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109572478 (ADCY7)
   04371 Apelin signaling pathway
    109572478 (ADCY7)
   04020 Calcium signaling pathway
    109572478 (ADCY7)
   04072 Phospholipase D signaling pathway
    109572478 (ADCY7)
   04024 cAMP signaling pathway
    109572478 (ADCY7)
   04022 cGMP-PKG signaling pathway
    109572478 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109572478 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109572478 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109572478 (ADCY7)
   04062 Chemokine signaling pathway
    109572478 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    109572478 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    109572478 (ADCY7)
   04912 GnRH signaling pathway
    109572478 (ADCY7)
   04913 Ovarian steroidogenesis
    109572478 (ADCY7)
   04915 Estrogen signaling pathway
    109572478 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    109572478 (ADCY7)
   04921 Oxytocin signaling pathway
    109572478 (ADCY7)
   04926 Relaxin signaling pathway
    109572478 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    109572478 (ADCY7)
   04918 Thyroid hormone synthesis
    109572478 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    109572478 (ADCY7)
   04916 Melanogenesis
    109572478 (ADCY7)
   04925 Aldosterone synthesis and secretion
    109572478 (ADCY7)
   04927 Cortisol synthesis and secretion
    109572478 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109572478 (ADCY7)
   04270 Vascular smooth muscle contraction
    109572478 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    109572478 (ADCY7)
   04971 Gastric acid secretion
    109572478 (ADCY7)
   04972 Pancreatic secretion
    109572478 (ADCY7)
   04976 Bile secretion
    109572478 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    109572478 (ADCY7)
   04727 GABAergic synapse
    109572478 (ADCY7)
   04725 Cholinergic synapse
    109572478 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    109572478 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109572478 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    109572478 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    109572478 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109572478 (ADCY7)
   04714 Thermogenesis
    109572478 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109572478 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    109572478 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109572478 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109572478 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109572478 (ADCY7)
   05163 Human cytomegalovirus infection
    109572478 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109572478 (ADCY7)
Enzymes [BR:biu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109572478 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 109572478
NCBI-ProteinID: XP_019834853
UniProt: A0A6P5D980
LinkDB
Position
18
AA seq 1097 aa
MLPRPWGFLRGPLGVPRWRMPAKGRYFLNEGEEGPDQDALYEKYRLTSQHGPLLLMLLLV
AIAACTTLIVITFSYGDPSRHRAVLGTAFFTLAXFVLLYALVYVECLDRRGLRISALLIW
ACLVTLGYVLVFDFDSPRKDTCVLGQVPFFLFVVFVVYTLLPFSMWGAVTAGLVSSISHL
LVLAMHQEDFTSPVGLKLLATAVVFVCGNLTGAFHKHHMQDASHDLFTYTVKCIQIRRKL
RIEKRQQENLLLSVLPAHISMGMKLAIIERLKERGDRRYLPDNNFHNLYVKRHQNVSILY
ADIVGFTRLASDCSPKELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPN
HARNCVKMGLDMCEAIKQVREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLA
NRMEAAGVPGRVHITEATLKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPQ
PSQHNSKNKGDATLKMRASVRMTRYLESWGAARPFAHLNQRESVSSSETLVSHGRRPKAV
PLRRHRTPDRSASPKGRSEDDSYDDEMLSAIEGLSSTRPCCSKSDDFXTFGSIFLEKGFE
REYRLAPIPRVRYYFACASLVFVCILLIHVLLLYSMKTLGVSFGLVACVLGLVLGLCFAD
VFLRCCPALGKLRAIAESVETQPLLRVSLAILTIGSLLVIAVVNLPLMPFRDRGLTAGNE
TGLRAVSGWEMSPCYLLPYYTCSCILAFIACSVFLRMSLELKVVLLTVALVAYLVLFNVY
PSWQWDCSGHSLGNLTGTNGTLSSSSSCSWHLKTMTNFYLVLFYTTLIXLSRQIDYYCRL
DCLWKKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFA
SVPDFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGL
SVPSGPENQDLERQHAHIGIMVEFSTALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIG
ARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCECRGLIDVKGKGELR
TYFVCTDTAKFQGLGLN
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgctccccaggccgtggggtttcctgcgtggaccactgggtgtgccaaggtggaggatg
ccagccaaggggcgctacttcctcaacgagggcgaggagggccccgaccaggatgcgctc
tacgagaagtaccgcctcaccagccagcacgggccactcctgctcatgctcctgttggtg
gccatcgctgcctgcaccacgctcatcgtcatcaccttcagctayggggacccctccaga
caccgggccgtcctggggacggcgttcttcacgctcgccrtgtttgtgctcctctacgct
ctggtgtacgttgagtgcctcgaccggcgggggctcaggatttccgcgctgctcatctgg
gcctgccttgtgacgctgggctacgtgttggtgtttgatttcgactcgccgaggaaggac
acctgtgtcttggggcaggtgcccttcttcctgttcgtggtcttcgtggtgtacacgctg
ctgcccttcagcatgtggggcgccgtcacggccggactcgtctccagcatctcccacctc
ctggtgctcgcaatgcaccaggaagacttcaccagccctgtggggctgaagctgctggcc
actgcggtggtcttcgtgtgcgggaacctcacaggcgccttccacaagcaccacatgcag
gacgcctcccacgacctcttcacctacacagtgaagtgcatccagattcggcgtaagctg
cgcatcgagaagcgccagcaggagaacctgctgctgtctgtgctgcctgcccacatctcc
atgggcatgaagctggccatcatcgagcggctcaaggagcgcggggaccgccgttacctg
cccgacaacaacttccacaacctctacgtcaagaggcaccagaatgtcagcatcctctac
gctgacatcgtgggcttcacgcgactggccagtgactgctcccccaaagagctggtggtg
gtgctgaatgagctcttcggcaagtttgaccagatcgccaaggccaacgagtgcatgcgg
attaagatcctgggwgactgctactactgcgtgtccggcttgcctgtgtccctgcccaac
cacgcccgtaactgtgtgaagatggggctggacatgtgtgaggccatcaagcaggtgcgg
gaggccacaggcgtggacatcagcatgcgcgtgggcatccactcggggaacgtgctgtgc
ggcgtcatcgggctgcgcaagtggcagtacgacgtgtggtcccacgatgtgtccctggcc
aacaggatggaggcggccggagtccctggccgggtgcacatcacagaggcgacgctgaag
cacctggacaaggcgtatgaggtggaggacgggcacgggcagcagcgggacccttacctc
aaagagatgaacatccgcacctacctggtcatcgacccccggagccagcagccgccccag
cccagccagcacaactccaagaacaagggggacgcgaccctgaagatgcgggcgtccgtg
cgcatgacgcgctacctggagtcctggggggcggctcgccccttygcgcacctcaaccaa
cgcgagagcgtgagcagcagtgagacccttgtgtcccatgggcggaggcccaaggctgtt
cccctgaggcgccatcggacccctgacagaagygcatcccccaaggggcggtcagaggac
gactcatacgatgatgagatgctgtcagccatcgaggggctcagctctaccagaccctgc
tgctccaagtctgatgacttcyccacctttgggtccatcttcctggagaagggcttcgag
cgagagtaccgcctggcgcccatcccccgggtccgctactacttcgcttgtgccagcctc
gtcttcgtctgcatcctgctcatccacgtcttgctgttgtacagtatgaagactctgggc
gtgtcctttgggctggtggcctgtgtgcttgggctggtactaggcttgtgcttygccgat
gtgttcttgaggtgctgcccggccctggggaagctccgagccattgccgagagcgtggag
acgcagcccctgctgcgggtgtccctggccatcctgaccatcggcagcctgctcgtcatt
gctgtcgtcaacctgcccctgatgcccttccgggaccgggggctgactgctgggaacgag
acgggcctgagggctgtgagcggctgggagatgagcccgtgctacctcctcccgtactac
acctgcagctgcatcctggccttcatcgcttgctctgtcttcctgcggatgagcctggag
ctgaaggtcgtgctgctgaccgtggccttggtggcctacctggtcctcttcaacgtctac
ccgagctggcagtgggactgcagtggccacagcctgggcaacctcaccgggaccaatggc
accctcagcagctcctcatcctgttcatggcatctgaagacgatgaccaatttctacctg
gtcttgttctacaccaccctcatcatsctctccagacagattgactattattgccgcctg
gactgtctgtggaagaagaagttcaagaaggaacacgaggagtttgaaacaatggagaat
gtgaaccgccttcttctagagaatgtcctgcccgcgcacgtggccgcccacttcatcggt
gacaagttaaatgaggactggtaccatcagtcctacgactgcgtgtgtgtcatgtttgcg
tcggtgccggactttaaagtcttctacacagagtgcgacgtcaacaaggaagggctggag
tgcctgcgcctgctcaacgagatcatcgcygactttgacgagctgctgttaaagcctaag
ttcagtggtgtggagaagatcaagaccatcggcagcacgtacatggccgctgcggggctc
agcgtcccctcggggcctgagaaccaggacctggagcggcagcacgcccacatcggcatc
atggtagagttcagcaccgccctgatgagcaagctggacggcatcaatcggcactccttc
aactcctttcgcctccgagtcggcataaaccatgggcctgtgattgctggagtgattggg
gcacgaaaacctcagtacgacatctggggaaacacggtcaatgttgccagtcgaatggag
agcactggagaacttggaaaaatccaggttactgaagagacatgtaccatcctccaggga
ctagggtattcctgtgagtgccgcgggctgattgacgtcaaaggcaaaggtgaactgagg
acttactttgtctgtacggacaccgccaagttccaaggcctggggctgaactga

KEGG   Bos indicus (zebu cattle): 109574822
Entry
109574822         CDS       T04792                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase type 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00230  Purine metabolism
biu01100  Metabolic pathways
biu01522  Endocrine resistance
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04114  Oocyte meiosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04611  Platelet activation
biu04713  Circadian entrainment
biu04714  Thermogenesis
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04727  GABAergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04913  Ovarian steroidogenesis
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04921  Oxytocin signaling pathway
biu04922  Glucagon signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu04976  Bile secretion
biu05032  Morphine addiction
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109574822 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109574822 (ADCY2)
   04371 Apelin signaling pathway
    109574822 (ADCY2)
   04020 Calcium signaling pathway
    109574822 (ADCY2)
   04072 Phospholipase D signaling pathway
    109574822 (ADCY2)
   04024 cAMP signaling pathway
    109574822 (ADCY2)
   04022 cGMP-PKG signaling pathway
    109574822 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109574822 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109574822 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109574822 (ADCY2)
   04062 Chemokine signaling pathway
    109574822 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    109574822 (ADCY2)
   04922 Glucagon signaling pathway
    109574822 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    109574822 (ADCY2)
   04912 GnRH signaling pathway
    109574822 (ADCY2)
   04913 Ovarian steroidogenesis
    109574822 (ADCY2)
   04915 Estrogen signaling pathway
    109574822 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    109574822 (ADCY2)
   04921 Oxytocin signaling pathway
    109574822 (ADCY2)
   04926 Relaxin signaling pathway
    109574822 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    109574822 (ADCY2)
   04918 Thyroid hormone synthesis
    109574822 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    109574822 (ADCY2)
   04916 Melanogenesis
    109574822 (ADCY2)
   04925 Aldosterone synthesis and secretion
    109574822 (ADCY2)
   04927 Cortisol synthesis and secretion
    109574822 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109574822 (ADCY2)
   04270 Vascular smooth muscle contraction
    109574822 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    109574822 (ADCY2)
   04971 Gastric acid secretion
    109574822 (ADCY2)
   04972 Pancreatic secretion
    109574822 (ADCY2)
   04976 Bile secretion
    109574822 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    109574822 (ADCY2)
   04727 GABAergic synapse
    109574822 (ADCY2)
   04725 Cholinergic synapse
    109574822 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    109574822 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109574822 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    109574822 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    109574822 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109574822 (ADCY2)
   04714 Thermogenesis
    109574822 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574822 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    109574822 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109574822 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109574822 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109574822 (ADCY2)
   05163 Human cytomegalovirus infection
    109574822 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109574822 (ADCY2)
Enzymes [BR:biu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109574822 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 109574822
NCBI-ProteinID: XP_019838349
UniProt: A0A6P5DKR0
LinkDB
Position
20
AA seq 972 aa
MGYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSA
TPGAKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQ
QERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGF
TRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCV
KMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAG
GVPGRVHISSVTLQHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRP
RHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRT
LRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKIIEKEYRATALPA
FKYYVTCACLIFFCIFIVQVLVLPKTSILGISFGAAFLSLAFILFVCFAGQLLQCSKKAS
ASLLWLLKSSGIIANRPWPRISLTVITTAIILTMAVFNMFFLSDSEETILPTANASNTSL
SGASNQAAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMAALVGYNTIFLH
THAPLLDDYSQVLFERPGIWKDLKTMGSVSLFIFFITLLVLGRQNEYYCRLDFLWKNKFK
KEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEF
YTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEH
AQEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYD
IWGNTVNVASRMDSTGVLDKIQVTEETSIILQTLGYTCTCRGIINVKGKGDLKTYFVNTE
MSRSLSQSNLTS
NT seq 2919 nt   +upstreamnt  +downstreamnt
atgggctacttgttcatgtgtttcgggggcaccgtctctccctgggaccaggtgtcattc
ttcctcttcatcatcttcgtggtgtacaccatgctgcccttcaacatgcgagatgccatc
atcgccagtgtcctcacctcctcttctcacaccatcgtgctgagcgtctgcctgtctgca
acaccaggggccaaggagcacctggtctggcagatcctggccaacgtgatcatcttcatc
tgcgggaacctggcgggggcataccataagcacctcatggagctcgctctgcagcagacg
tatcaggacacgtgcaactgcatcaagtcccggatcaagctggaatttgaaaaacgtcag
caggagcggctgctgctgtccctgctgccggcacacatagccatggagatgaaagcggag
atcatccagaggctgcagggcccmaaagccggccagatggagaacaccaacaacttccac
aacctctacgtcaagcggcacaccaacgtcagtatcctctatgcggacattgttgggttc
acccgtctggccagtgactgctcccctggagagctcgtccatatgctgaatgaactcttt
ggaaagttcgatcaaattgcaaaggagaatgaatgcatgagaataaaaattttaggagac
tgctactactgtgtgtccggactgcctatatctctccctaaccatgccaagaattgtgtg
aaaatgggactggatatgtgtgaagccataaagaaagtgagggacgccaccggagtggac
atcaacatgcgcgtgggagtgcattctgggaacgtgctgtgcggcgtgatcgggctgcag
aagtggcagtacgacgtgtggtcacatgacgtcaccctggccaaccacatggaagctgga
ggggtccctggacgtgttcacatttcttctgttaccctgcaacacttgaatggagcttac
aaagtggaagaaggcgatggtgacatcagagacccgtatttaaagcaacatttggtgaaa
acttactttgtaatcaaccccaagggagagcggcggagccctcagcacctctttaggcct
cgacacacccttgacggagcgaagatgagggcttctgtccgcatgacccggtacctggag
tcctggggggcggccaagccctttgcacacctgcatcacagagacagcatgactacggag
aacggcaagatcagcaccacggatgtaccaatgggtcagcataattttcaaaatcgcacc
ttaagaaccaagtcacaaaagaaaagatttgaagaggaattaaatgaaaggatgattcaa
gcaattgatggaatcaatgcacaaaagcaatggctcaagtcygaagacattcagagaatc
tcattgcttttctacaataaaataatagaaaaagaataccgagccaccgcactgccggcc
ttcaagtattacgtgacttgcgcttgcctgatcttcttctgcatctttatcgtgcaggtt
ctggtcttacccaaaacgtccattctcggratttcctttggagcggcgtttctctcactt
gcctttatccttttcgtctgctttgctggacagcttttgcaatgcagcaagaaagcatct
gcttctctcctgtggcttttaaagtcatcgggcatcatcgccaaccggccctggcctcgg
atctccctgacggtcatcaccacrgccatcatattgaccatggccgtgttcaatatgttt
ttcctgagtgactcagaggaaacaattcttccgactgccaacgcgtccaacacaagtctt
tctggcgcaagtaaccaggcagcaattctgcgtgcgcaaaatttgtttttcctgccgtac
tttatatacagctgcatccttgggctgatctcctgttccgtcttcctgcgtgtgaattac
gagctgaagatgctgatcatgatggcagccttggtgggctacaacaccatcttcctccac
actcacgctcccctcctggacgactacagccaggtcctgttcgagagaccaggcatttgg
aaagacctaaagaccatgggctcagtatctctctttatatttttcatcacactgcttgtt
ctgggcagacagaatgaatattactgtaggttagacttcttatggaagaacaagttcaaa
aaagagcgggaggagatagaaaccatggagaacttgaaccgagtgctgctggagaacgtg
cttcctgcgcacgtggctgagcacttcctggcgcggagcctgaagaacgaggagttatac
caccagtcctacgactgcgtctgcgtcatgtttgcctccattcctgatttcaaagaattc
tatacagaatcagacgtgaacaaggagggtttggaatgccttcggctcctgaacgagatc
attgccgactttgatgatctgctctccaagccgaagttcagtggtgttgaaaagatcaag
accatcggcagcacgtacatggcagcgacaggtctgagcgcggtgcccagccaggagcac
gcccaggagccggagaggcagtacatgcacattggcaccatggtggagtttgcatttgcc
ctggtggggaagctggatgccatcaacaagcactccttcaatgacttcaagttacgagta
ggtattaaccatggccctgtcatagccggtgtgattggagctcagaagccgcagtatgac
atctggggcaacaccgtcaatgtggccagcaggatggacagcaccggagtcctggacaaa
atccaggtgacagaggagacgagcatcatcctacagaccctaggctacacgtgcacgtgt
cggggaatcatcaacgtgaaaggaaagggggacctgaagacctacttcgtcaacacggag
atgtcacggtccctttctcagagcaacctgacctcctga

KEGG   Bos indicus (zebu cattle): 109578364
Entry
109578364         CDS       T04792                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase type 9 isoform X1
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00230  Purine metabolism
biu01100  Metabolic pathways
biu01522  Endocrine resistance
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04114  Oocyte meiosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04611  Platelet activation
biu04713  Circadian entrainment
biu04714  Thermogenesis
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04727  GABAergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04913  Ovarian steroidogenesis
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04921  Oxytocin signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04961  Endocrine and other factor-regulated calcium reabsorption
biu04962  Vasopressin-regulated water reabsorption
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu04976  Bile secretion
biu05032  Morphine addiction
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109578364 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109578364 (ADCY9)
   04371 Apelin signaling pathway
    109578364 (ADCY9)
   04020 Calcium signaling pathway
    109578364 (ADCY9)
   04072 Phospholipase D signaling pathway
    109578364 (ADCY9)
   04024 cAMP signaling pathway
    109578364 (ADCY9)
   04022 cGMP-PKG signaling pathway
    109578364 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109578364 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109578364 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109578364 (ADCY9)
   04062 Chemokine signaling pathway
    109578364 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    109578364 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    109578364 (ADCY9)
   04912 GnRH signaling pathway
    109578364 (ADCY9)
   04913 Ovarian steroidogenesis
    109578364 (ADCY9)
   04915 Estrogen signaling pathway
    109578364 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    109578364 (ADCY9)
   04921 Oxytocin signaling pathway
    109578364 (ADCY9)
   04926 Relaxin signaling pathway
    109578364 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    109578364 (ADCY9)
   04918 Thyroid hormone synthesis
    109578364 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    109578364 (ADCY9)
   04916 Melanogenesis
    109578364 (ADCY9)
   04925 Aldosterone synthesis and secretion
    109578364 (ADCY9)
   04927 Cortisol synthesis and secretion
    109578364 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109578364 (ADCY9)
   04270 Vascular smooth muscle contraction
    109578364 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    109578364 (ADCY9)
   04971 Gastric acid secretion
    109578364 (ADCY9)
   04972 Pancreatic secretion
    109578364 (ADCY9)
   04976 Bile secretion
    109578364 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109578364 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109578364 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    109578364 (ADCY9)
   04727 GABAergic synapse
    109578364 (ADCY9)
   04725 Cholinergic synapse
    109578364 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    109578364 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109578364 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    109578364 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    109578364 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109578364 (ADCY9)
   04714 Thermogenesis
    109578364 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109578364 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    109578364 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109578364 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109578364 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109578364 (ADCY9)
   05163 Human cytomegalovirus infection
    109578364 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109578364 (ADCY9)
Enzymes [BR:biu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109578364 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 DUF1053
Other DBs
NCBI-GeneID: 109578364
NCBI-ProteinID: XP_019843027
UniProt: A0A6P5E1J3
LinkDB
Position
25
AA seq 1355 aa
MASPPHQQLLQHHSTEVSCDSSGDSNSVRVRINPKQPSSNSHPKHCKYSISSSCSSSGDS
GGVPRRMGAGGRLRRRKKLPQLFERASSRWWDPKFDSVNLEEACMERCFPQTQRRFRYAL
FYIGFACLLWSIYFGVHMKSKLIVMVAPALCFLVVCVGFFLFTFTKLYARHYVWTSLVLT
LLVFALTLAAQFQVLTPLSGRVDNFNHTRAARPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLILGVAYSVLFETFGYHFQDEACFASPGAEALHWELLSRALLHLCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVTERLGQSVVADQLKGLKTYLIAGQRAKESHCSCSEALLSGFEVLDGSRVS
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFTPKPEAGAEGGAVQNGCQEEPKN
SAKASGGPSSKTQNGLLSPPPEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDPELERAYRTSYQEEQVVKSSPVRT
FASATFSSLLDVLLSTTVFLILSITCFLRYGAASTPPPPAALAVFGAALLLEILSLVVSV
RMVFFLEDVMTCTKRLLEWIAGWLPRHFIGAILVSLPALAVYSHVTSEFETNIHSTMFTG
SAVLTAVVQYCNFCQLSSWMRSSLATVVGAGPLLLLLYVSLCPDSSTVISHLDAVQNFSS
TRKLCNASLPHDGRSPASLIGQEVILVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHR
TKIQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGG
KECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNATQCRDGSHPQEHLQIL
FEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMD
TTGVECRIQVSEESYRVLSKMGYEFDYRGTVNVKGKGQMKTYLYPKCTDSGLVPQHQLSI
SPDIRVQVDGSIGRSPTDEIASLVPSVQNPDQVSPGSENNAQTRDAHPSAKRPWKEPVRA
EERCRFGKAIEKSDCEEVGMEEANELTKLNVSERA
NT seq 4068 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcagcaccacagcaccgaggtgagctgtgac
tccagcggagacagcaacagcgtgcgggtcaggatcaaccccaagcagccgtcctccaac
agccacccgaagcactgcaagtacagcatctcctccagctgcagcagctccggggactcc
ggaggggtcccccgaagaatgggcgcaggaggccgcctgcgcaggaggaagaagctgccc
cagctgttcgaacgggcctccagccggtggtgggaccccaagtttgactctgtgaacctg
gaggaggcttgcatggagcgttgcttcccgcagacccagcgccgcttccggtatgcgctc
ttctacatcggcttcgcctgccttctctggagcatctattttggggtccacatgaaatcg
aaactgattgtcatggtagcccctgctctgtgcttcctcgtggtgtgtgtgggctttttt
ctgtttaccttcaccaagttgtacgcccgccattacgtgtggacttcgctggttctcacc
ctcctggtattcgccctgaccctggctgcccagtttcaggttttgacgcccctctcagga
cgagttgacaacttcaatcatactcgggctgccaggcccacagacacttgcttatctcaa
gtggggagcttttccatgtgcatcgaagtgctctttttgctctacaccgtcatgcactta
cctttgtacttgagcttgattttgggagtggcctattctgttctttttgagacctttggc
taccacttccaagatgaagcctgctttgcctcacctggagcggaggctctgcactgggag
ctgctgagccgggccctgctccacctctgcatccacgccatcgggatccacctgttcatc
atgtcccaggtgagatccaggagcaccttcctcaaggtgggccagtctattatgcacgga
aaggatctggaagtggaaaaggccctgaaagagaggatgattcattctgtgatgccaaga
atcatagctgatgacttgatgaaacagggggatgaggagagcgagaattctgtcaaaagg
cacgccacctccagccccaagaacaggaagaagaagtcttccatccagaaagcccctatc
gccttccgcccgtttaagatgcagcagatcgaagaagtcagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaataagtctgcccacgccctggtgggtctcctcaac
gatctgttcggccgctttgaccggttgtgtgaggagaccaaatgtgagaaaatcagcacc
ttgggagactgctactattgtgtggctgggtgtcctgagccaagggccgaccatgcctac
tgctgcatcgagatggggttgggcatgataagagccattgagcagttctgccaagagaag
aaagagatggtgaacatgcgcgttggggttcacacagggaccgtcctgtgtggcatcttg
ggcatgaggaggtttaaatttgacgtgtggtccaatgatgtgaacttggccaatctcatg
gagcagctgggagtggctggcaaggttcacatttccgaggccactgcaaaatacctagat
gaccggtacgaaatggaggatgggaaagttactgaacgccttggccagagtgttgttgct
gaccagttgaaaggtttgaagacatacctgatagcgggtcagagagcgaaggagtctcac
tgcagctgttcagaggccttactttctggctttgaggtccttgacggctcgcgggtgtcc
tcaggccctaggggacaggggacagcgtcgccagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccatcgtgyggaatcacgttcactcccaag
ccagaagctggtgcagaaggtggagcggtccagaacggctgtcaggaggagcccaagaac
agtgccaaggcctccggaggacccagctccaaaacgcaaaatggacttctgagtcctccc
ccggaggagaagctcaccaacagtcagacctccctgtgcgagatcttacaggagaagggc
aggtgggcaggcgtgagcctggatcagtcagctctccttccgctgaggttcaagaacatc
cgggagaaaacggatgcccactttgttgacgttatcaaggaagacagcctgatgaaagac
tacttttttaagccgcccattaaccagttcagcttgaacttcctggatccggagctcgag
cgggcctacaggaccagctatcaagaagagcaggttgtaaagagctctcccgtgaggact
ttcgccagtgccaccttcagctccctcctggatgtgcttctgtcgacaacagtgtttctg
attctctccatcacctgcttcctgaggtacggggccgcctccacgccgcccccgccggcc
gccctggcagtcttcggagcggccctgctgctggagatcctgtccctcgtggtctctgtc
aggatggtgttcttcctggaggacgtgatgacgtgcacgaagcgcctgctggagtggata
gccggctggctcccgcgccatttcatcggggccatcctggtgtctctccccgccctggcg
gtgtattcacacgtcacctctgaatttgaracaaacatacactccaccatgttcacgggc
tcggccgtgctgaccgccgtggtgcaatactgcaacttctgccagctcagctcctggatg
cggtcctccctggccactgtcgtcggggccgggcccctgctgctgctgctctacgtctcc
ctgtgcccggacagttccactgtaatttcacaccttgatgcagtacagaatttcagctcc
accaggaagctgtgcaacgcctcgctgcctcacgacggcaggagcccagccagcctgatc
ggccaggaggtgattctcgtcttcttcctcctgctcctgttggtctggttcctgaaccga
gagttcgaagtcagctaccgcctgcactaccatggggacgtggaggcggacctgcaccgc
accaagatccagagcatgagggaccaggccgactggctgctgcggaacatcatcccctac
cacgtggccgagcagctcaaggtgtcccagacctactccaagaaccacgacagcggaggc
gtcatcttcgccagcatcgtcaacttcagcgagttctacgaggagaactacgagggcggc
aaggagtgctacagggtcctcaacgagctgatcggggactttgacgagctcctgagcaag
ccggactacagcagcatcgagaagatcaagaccatcggggccacgtacatggccgcgtcc
gggctgaacgccacgcagtgccgcgacggcagccacccgcaggagcacctgcagatcctc
ttcgagttcgccaaggagatgatgcgtgtggtggacgacttcaacaacaacatgctgtgg
ttcaacttcaagctcagggtgggcttcaaccacgggcccctgacggcgggcgtcatcggc
accaccaagctgctgtacgacatctggggggacacggtcaacatcgccagcaggatggac
accacgggggtggagtgccgcatccaggtcagcgaggagagctaccgcgtcctgagcaag
atgggctacgagttcgactaccgagggacggtgaacgtcaagggcaaaggccaaatgaag
acctacctgtaccccaagtgcacagacagtgggttggtgccacagcaccagctgtccatc
tcacccgacatccgggtccaggtggatggcagcatcggacgctcccccacagacgagata
gccagcctggtgccttccgttcagaacccggaccaggtgtccccaggttccgagaacaac
gcccagaccagggacgctcacccgtctgctaagagaccctggaaggagccagtcagagcc
gaggaaaggtgtcggttcggcaaagccatagagaaaagcgactgtgaagaagtggggatg
gaggaagccaacgaactcacgaagctcaacgtctcagagagggcgtga

DBGET integrated database retrieval system