KEGG   Bos indicus (zebu cattle): 109555924
Entry
109555924         CDS       T04792                                 

Gene name
WNT2B
Definition
(RefSeq) protein Wnt-2b
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109555924 (WNT2B)
   04390 Hippo signaling pathway
    109555924 (WNT2B)
   04150 mTOR signaling pathway
    109555924 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109555924 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109555924 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109555924 (WNT2B)
   05205 Proteoglycans in cancer
    109555924 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109555924 (WNT2B)
   05226 Gastric cancer
    109555924 (WNT2B)
   05217 Basal cell carcinoma
    109555924 (WNT2B)
   05224 Breast cancer
    109555924 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109555924 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    109555924 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109555924 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109555924 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109555924 (WNT2B)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109555924 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 109555924
NCBI-ProteinID: XP_019812385
UniProt: A0A6P5BNE7
LinkDB
Position
3
AA seq 394 aa
MLRPGGAEEAAQLPPRRVSAPVPESAPRSTAPDGSRASARLSLACLLLLLLLLTLPARVD
TSWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWN
CTTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHH
DQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLEC
KCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRT
DLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCEC
KFHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgctgaggccgggtggtgcggaggaagccgcgcagctaccccctcgacgcgttagcgcc
cctgtccccgagtccgctcccagatccacggcccccgacggctctcgggcttcggcccgc
ctaagtcttgcctgccttctgttgctgctactgctgctgacgctgccggcccgcgtagac
acgtcctggtggtacatcggggcactaggggcccgtgtgatctgtgacaatatccctggg
ctggtgagccggcagcggcagctgtgccagcgttacccagacatcatgcgctccgtgggt
gagggtgcccgagagtggatmmgagagtgtcagcaccagttccgccatcatcgctggaac
tgcaccaccctggaccgggaccacactgtctttggccgtgtcatgctcagaagtagccgg
gaggcagcatttgtatacgccatctcatcagcaggggtggtccatgctatcactcgkgcc
tgtagccagggtgaactgagtgtgtgcagttgtgacccctatacccgtggccgacaccat
gaccaacgtggggactttgactggggtggctgcagtgacaacatacactatggtgttcgc
tttgccaaagccttcgtggatgccaaggagaagaggcttaaggatgcccgggctctcatg
aacttacataacaatcgctgtggtcgcacggctgtgcggcggtttctgaagctggagtgt
aagtgccatggcgtgagtggctcctgtactctgcgcacctgctggcgtgcactctcagat
ttccgccgcacaggtgattacctgcggcggcgctatgacggggctgtgcaagtaacggcc
acccaggatggcgcaaacttcacggcagctcgccaaggctatcgccgtgctacccggact
gacctggtctactttgacaactccccagactactgtgtcttggacaaggctgcaggttcc
ctaggcactgcaggccgagtctgtagcaagacatctaaagggacagacggttgtgaaatc
atgtgctgcggccgagggtatgacacaactcgagttacccgtgtcacccagtgtgagtgc
aaattccactggtgctgtgctgtgcggtgcaaggagtgcagaaacactgtggacgtccat
acttgcaaggcccccaagaaggcagagtggctggatcagacctga

KEGG   Bos indicus (zebu cattle): 109557407
Entry
109557407         CDS       T04792                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109557407 (WNT2)
   04390 Hippo signaling pathway
    109557407 (WNT2)
   04150 mTOR signaling pathway
    109557407 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109557407 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109557407 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109557407 (WNT2)
   05205 Proteoglycans in cancer
    109557407 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109557407 (WNT2)
   05226 Gastric cancer
    109557407 (WNT2)
   05217 Basal cell carcinoma
    109557407 (WNT2)
   05224 Breast cancer
    109557407 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109557407 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    109557407 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109557407 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109557407 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109557407 (WNT2)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109557407 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 109557407
NCBI-ProteinID: XP_019814272
UniProt: A0A6P5BK19
LinkDB
Position
4
AA seq 360 aa
MNACLVGIWLWLPLLFTWLSPEVSSSWWYMRATSGSSRVMCDNVPGLVSHQRQLCHRHPD
VMRAIGLGVTEWTMECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGTAKDNKGTFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGNYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHITRKTKCECKFHWCCAVRCQDCVEALDVHTCKAPKSPDWAAPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcctgtctcgttggaatctggctctggctccctctactctttacctggctcagc
cctgaggtcagctcttcatggtggtacatgagagctacgagtggctcctccagggtgatg
tgtgacaacgtgccaggcctggtgagccaccaacggcagctgtgccaccgacacccggat
gtgatgcgtgccatcggcctgggcgttactgagtggacgatggagtgccagcaccagttc
cgccagcaccgctggaactgcaacaccctggacagggatcacagcctcttcggcagggtc
ctgctccgaagtagccgggaatctgcgtttgtttacgccatctcttcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaattaaaatcctgttcctgtgacccaaag
aagaagggaaccgccaaggataacaagggcacttttgactggggtggctgcagtgataac
attgactatgggatcaagtttgccagagcgtttgtggatgccaaggaaaggaaaggcaag
gatgccagagccctgatgaatcttcacaacaaccgagccggcaggaaggctgtaaagagg
ttcttgaaacaggagtgcaagtgtcatggcgtgagcggttcctgtaccctgaggacctgc
tggctggccatggctgacttcaggaaaacgggcaattatctctggaggaagtacaatggg
gccatccaggttgtcatgaaccaggatggcactggtttcactgtggctaacaagaggttt
aaaaagccaacgaaaaatgacctcgtgtattttgagaattctccagactactgtatcagg
gaccgagatgcaggctccctgggtacagcgggccgtgtgtgcaacctgacttcccggggc
atggacagctgcgaagtcatgtgctgtggcagaggctacgacacctcccacattacccgg
aagaccaagtgtgagtgtaagttccactggtgctgtgccgtgcgctgccaggactgcgtg
gaggccctggacgtgcacacgtgcaaggccccgaagagccccgactgggctgctccgaca
tga

KEGG   Bos indicus (zebu cattle): 109558644
Entry
109558644         CDS       T04792                                 

Gene name
WNT7B
Definition
(RefSeq) protein Wnt-7b
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109558644 (WNT7B)
   04390 Hippo signaling pathway
    109558644 (WNT7B)
   04150 mTOR signaling pathway
    109558644 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109558644 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109558644 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109558644 (WNT7B)
   05205 Proteoglycans in cancer
    109558644 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109558644 (WNT7B)
   05226 Gastric cancer
    109558644 (WNT7B)
   05217 Basal cell carcinoma
    109558644 (WNT7B)
   05224 Breast cancer
    109558644 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109558644 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    109558644 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109558644 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109558644 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109558644 (WNT7B)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109558644 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 109558644
NCBI-ProteinID: XP_019815548
UniProt: A0A6P5BB86
LinkDB
Position
5
AA seq 381 aa
MAGEGLGLDRGLSAAALGGGCPSGPGPAPLGGGQLAGQLQSPMFCDSCTPPGSSVIALSS
VVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALG
EKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWK
WGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEERMKLECKCHGVSGS
CTTRTCWTTLPKFREVGHLLKEKYNVAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDL
VYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKF
HWCCFVKCNTCSERTEVFTCK
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggcgggagaggggcttggcctcgacaggggtcttagtgcggcagcgctgggaggaggc
tgcccctcagggcccggcccggctcctctgggcggaggacagctagcaggccagctacaa
agccccatgttctgcgactcatgcacccctccaggcagttctgtgatagccctgtcatcc
gtcgtggccctgggagccaacatcatctgcaacaagattcctggcctggccccgcggcag
cgcgccatctgtcagagccggcccgatgccatcatcgtgattggggagggggcgcagatg
ggcatcaacgagtgccagtaccagttccgcttcgggcgctggaactgctccgccctcggc
gagaagaccgtcttcgggcaagagctccgagtagggagccgtgaggccgccttcacctac
gccatcaccgcggccggcgtggcccacgcggtcaccgccgcctgcagccagggcaacctc
agcaactgcggctgcgaccgcgagaagcagggctactacaaccaggccgagggctggaag
tggggcggctgctccgccgacgtgcgctatggcattgacttctcccggcgcttcgtggac
gcccgcgagatcaagaaaaacgccaggcgcctcatgaacctgcacaacaacgaggcgggc
aggaaggtcctggaggagcgcatgaagctggagtgcaagtgccacggcgtgtccggctcc
tgcaccaccaggacgtgctggaccacgctgcccaagttccgcgaggtgggccacctgctg
aaggagaagtacaacgtggccgtgcaggtggaggtggtgcgcgccagccgcctgcgccag
cccaccttcctgcgcatcaagcagctgcgcagctaccagaagcccatggagacggacctg
gtgtacatcgagaagtcccccaactactgcgaggaggacgcggccacgggcagcgtgggc
acgcagggccgcctgtgtaaccgcacgtcgcccggcgcagacggctgcgacaccatgtgc
tgcggccggggctacaacacccaccagtacaccaaggtctggcagtgcaactgcaagttc
cactggtgctgcttcgtcaagtgcaacacgtgcagcgagcgcaccgaggtcttcacctgc
aagtga

KEGG   Bos indicus (zebu cattle): 109558697
Entry
109558697         CDS       T04792                                 

Gene name
WNT1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109558697 (WNT1)
   04390 Hippo signaling pathway
    109558697 (WNT1)
   04150 mTOR signaling pathway
    109558697 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109558697 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109558697 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109558697 (WNT1)
   05205 Proteoglycans in cancer
    109558697 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109558697 (WNT1)
   05226 Gastric cancer
    109558697 (WNT1)
   05217 Basal cell carcinoma
    109558697 (WNT1)
   05224 Breast cancer
    109558697 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109558697 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    109558697 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109558697 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109558697 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109558697 (WNT1)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109558697 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 109558697
NCBI-ProteinID: XP_019815595
UniProt: A0A6P5BS69
LinkDB
Position
5
AA seq 370 aa
MGHWALLPCWVSAALLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTASGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGNNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggcactgggcgctgctgccttgctgggtttctgctgcgttgttgctggcgctggcc
gctctgcctgcagccctggccgccaacagcagtggccgatggtggggcatcgtgaacgta
gcctcctccacgaacctgctgaccgattccaagagtctgcagctggtactcgagcccagt
ctgcagctgctgagccgcaaacagcggcggctgatccgccagaacccggggatcctgcac
agcgtgagcggggggctgcagagcgctgtgcgagagtgcaagtggcagttccggaaccgc
cgctggaactgtcccacggcttcggggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgggaaacagcctttatcttcgccatcacctcggccggggtcacccactcggtggcg
cgctcctgctcagagggctccatcgaatcctgcacgtgcgactatcggcggcgcggtcct
gggggccccgattggcactggggaggctgcagcgacaacatcgacttcggccgcctcttc
ggccgggagtttgtggactcgggagagaaggggcgggaccttcgcttcctcatgaacctt
cacaacaatgaggcggggcgcacgaccgtgttctccgagatgcgccaggagtgcaagtgc
cacgggatgtcgggctcatgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gcagtgggcgacgtgctgcgggaccgcttcgacggtgcctcgcgcgtcctctacggcaac
cgcggcaacaaccgtgcatcgcgggcggaactgctgcgcctggagccggaggacccggct
cacaagcctccctcgccccacgacctcgtctacttcgagaagtcgcccaacttctgcacg
tacagcggacgcctgggtactgcgggcacggcgggtcgcgcctgcaatagctcgtcgccc
gcgctggatggctgcgagctgctctgctgtggccggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgcctgtga

KEGG   Bos indicus (zebu cattle): 109559150
Entry
109559150         CDS       T04792                                 

Gene name
WNT10B
Definition
(RefSeq) protein Wnt-10b
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109559150 (WNT10B)
   04390 Hippo signaling pathway
    109559150 (WNT10B)
   04150 mTOR signaling pathway
    109559150 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109559150 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109559150 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559150 (WNT10B)
   05205 Proteoglycans in cancer
    109559150 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109559150 (WNT10B)
   05226 Gastric cancer
    109559150 (WNT10B)
   05217 Basal cell carcinoma
    109559150 (WNT10B)
   05224 Breast cancer
    109559150 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109559150 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    109559150 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109559150 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109559150 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109559150 (WNT10B)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109559150 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 109559150
NCBI-ProteinID: XP_019816228
UniProt: A0A6P5BDK5
LinkDB
Position
5
AA seq 391 aa
MREEPRXXPPPLGLAGLLFLALCSRALGNEIQGLKLPGGGEPPLTANTVCLTLSGLSKQQ
LGLCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESA
FSFSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFSHSLP
SSGPGSGPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQV
VTENLKRKCKCHGTSGSCQLKTCWRAPPEFRAVGAALRERLDRAIFIDTHNRNSGAFQPR
LRPRRLSGELVYFENSPDFCERDPTVGSPGTQGRACNKTSHQLGSCGSLCCGRGHNVLRQ
TRVERCNCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgcgggaggagccccggcnnnnncctccgcccttgggcctcgccggtctcctgttcctg
gcgttgtgcagtcgggccctcggcaatgagattcagggcttgaagctgccgggcggcggc
gagccgccgctgaccgccaacaccgtgtgcttgacgctgtcgggcctgagcaagcagcag
ctgggcctgtgcctgcgcagccccgacgtgacggcgtcggcgctccagggcctgcacatc
gcggtccacgagtgccagcaccagctgcgggaccagcgctggaactgctcggcgctcgag
ggcggcggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgagagagcgct
ttttccttctccatgctggctgctggggtcatgcatgcggtagccaccgcctgcagcctg
ggcaagctggtgagctgtggctgtggctggaagggcagtggtgagcaggatcgactgagg
gcgaaactgctgcagctgcaggcactatcgcggggcaagagcttttcccactccctgccc
agctcgggccccggctccggtcccagccctggcccccaggacacgtgggaatggggcggc
tgtaaccatgacatggacttcggggagaagttctctcgggattttttggattccagggaa
gctcctcgggacatccaggcacgaatgcggatccacaacaacagggtggggcgtcaggtg
gtaactgaaaacctgaagcggaaatgcaagtgccatggtacgtcaggcagctgccagctc
aagacgtgctggagggcacccccagagttccgggcagtgggagcagccttgagggagcgg
ctggaccgggccatcttcattgatactcacaaccgcaactccggagcctttcaaccccgt
cttcggccccgtcgcctttcaggagagctggtctacttcgagaactctcctgacttctgt
gagcgagaccccactgtgggctccccaggcacgcagggccgggcctgcaacaagacgagc
caccagctgggtagctgtggcagcctgtgctgtggccgagggcacaacgtgctccggcag
acccgagtcgagcgctgtaattgccgcttccactggtgctgctacgtgctgtgtgacgag
tgcaaggtcacagagtgggtcaatgtgtgtaagtga

KEGG   Bos indicus (zebu cattle): 109559776
Entry
109559776         CDS       T04792                                 

Gene name
WNT5B
Definition
(RefSeq) protein Wnt-5b
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109559776 (WNT5B)
   04390 Hippo signaling pathway
    109559776 (WNT5B)
   04150 mTOR signaling pathway
    109559776 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109559776 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109559776 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    109559776 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559776 (WNT5B)
   05205 Proteoglycans in cancer
    109559776 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109559776 (WNT5B)
   05226 Gastric cancer
    109559776 (WNT5B)
   05217 Basal cell carcinoma
    109559776 (WNT5B)
   05224 Breast cancer
    109559776 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109559776 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    109559776 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109559776 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109559776 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109559776 (WNT5B)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109559776 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 109559776
NCBI-ProteinID: XP_019817302
UniProt: A0A6P5BVY2
LinkDB
Position
5
AA seq 358 aa
MPSLPALLALLFACWAPLRATASSWWSLAMSPVQRPEMFIIGAQPVCSQLPGLSAGQRKL
CQLYQEHMAYIGEGARTGIRECQHQFRQRRWNCSTVDDASVFGRVLQIGSRETAFTYAVS
AAGVVNAISRACREGELSTXXXXRAARPKDLPRDWLWGGCGDNVDYGYRFAKEFVDARER
EKNFAKGSEEQGRVLMNLQNNEAGRRAVYKTADVACKCHGVSGSCSLKTCWLQLAEFRKV
GDQLKEKYDSAAAMRITRRGKLELVNSRFKPPTPEDLVYVDPSPDYCLRDESTGSLGTRG
RLCNKTSEGLDGCALMCCGRGYDQFKSVRTERCHCKFHWCCFVRCKKCTQVVDQFVCK
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcccagcctgccggccctgctcgccttgctgttcgcctgctgggccccgctccgagcc
acagccagctcctggtggtccttggcgatgagcccggtgcagagacccgagatgttcatc
atcggggcccagcccgtgtgcagccagctcccggggctgtccgccggccagaggaagctg
tgccaactctaccaggagcacatggcctacatyggggagggcgccaggacrggcatcagg
gagtgccagcatcagttccggcagcgccggtggaactgcagcacggtggacgacgcctcc
gtctttgggagagtcctgcagatcgggagccgggagacagccttcacctacgccgtgagc
gcggctggggtggtgaatgccatcagccgtgcctgccgtgagggcgagctgtccacctnn
nnnnnnnnccgagccgcacggcccaaggacctgccccgggactggctgtggggcggctgc
ggcgacaacgtggactayggctaccgcttcgccaaggagttcgtggacgcccgcgaaagg
gagaagaacttcgccaagggctcagaggaacagggccgcgtgctcatgaacctgcagaac
aatgaggcaggccggagggctgtgtacaagacggcagacgtggcctgcaaatgccatggc
gtctctgggtcctgcagtctcaagacctgctggctgcagctggccgagttccgcaaggtg
ggggaccagctaaaggagaagtacgacagcgcggccgccatgcgcatcacccgccgcgga
aagctggagctagtcaacagccgcttcaagccgcccacccctgaggacctggtgtacgtg
gaccccagcccggactactgcctgcgcgatgagagcacgggctcgctgggcacgcggggc
cgcctgtgcaacaagacgtccgagggcctggacggctgtgcgctcatgtgctgcggccgc
ggctacgaccagttcaagagcgtgcggaccgagcgctgccactgcaagttccactggtgc
tgcttcgtccgctgcaagaagtgcacgcaggtcgtggaccagttcgtctgcaagtag

KEGG   Bos indicus (zebu cattle): 109560806
Entry
109560806         CDS       T04792                                 

Gene name
WNT9A
Definition
(RefSeq) protein Wnt-9a
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109560806 (WNT9A)
   04390 Hippo signaling pathway
    109560806 (WNT9A)
   04150 mTOR signaling pathway
    109560806 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109560806 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109560806 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109560806 (WNT9A)
   05205 Proteoglycans in cancer
    109560806 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109560806 (WNT9A)
   05226 Gastric cancer
    109560806 (WNT9A)
   05217 Basal cell carcinoma
    109560806 (WNT9A)
   05224 Breast cancer
    109560806 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109560806 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    109560806 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109560806 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109560806 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109560806 (WNT9A)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109560806 (WNT9A)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 109560806
NCBI-ProteinID: XP_019818854
UniProt: A0A6P5BZV6
LinkDB
Position
7
AA seq 385 aa
MQRRCLVGRGPRGSPPALLPSGSAAAPASAAAHPVPASLLWSRAHFGLCVPRLTGSEPLT
ILPLTLEPEAVAQAHYKACDRLKLERKQRRMCRRDPGVAETLVEAVSMSALECQYQFRFE
RWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENR
EAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGV
SGSCTVRTCWRQLAPFHEVGKRLKHKYETALKVGSTTNEATGEAGAISPPRGRAAGAGGG
DPLPRTPXXVHLDDSPSFCVAGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQ
CQVRWCCYVECRQCTQREEVYTCKG
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgcagagacgatgcctggtgggcaggggtcctcggggctcgccccccgccctgctgccg
tcaggttctgctgctgccccagcgtctgcagcagctcacccagtgccggcttccctcctc
tggagcagggctcattttggcctctgtgtgcccaggctgacgggcagtgagcccctgacc
atcctcccgctgaccctggagccagaagcagttgcccaggcccactacaaggcctgtgac
cggctgaagctggagcgcaagcagcggcgcatgtgccgccgggaccccggtgtggccgag
acgctggtggaggcggtcagcatgagtgccctygagtgccagtaccagttccgctttgag
cgctggaactgcaccttggagggccgctaccgggccagcctcctcaagcgaggcttcaag
gagacagccttcctttacgccatctcctccgctggcctgacgcacgcactggccaaggct
tgcagcgcaggccgcatggaacgctgcacttgcgatgaggcgcctgacttggagaaccgg
gaggcctggcagtggggcggctgcggagacaacctcaagtacagcagcaagttcgtcaag
gagttcctgggccggcggtctagcaaggatctgcgagcccgcgtggacttccacaacaac
ctcgtgggtgtgaaggtgatcaaggctggggtggagaccacgtgcaagtgccatggcgtg
tccggctcgtgcaccgtgcggacgtgctggcggcagctcgcgcctttccacgaggtgggc
aagcgcctgaagcacaagtacgagacggccctyaaggtgggcagcaccaccaacgaggcc
accggcgaggccggcgccatctcgccgccacggggccgggccgccggggcgggcggcggc
gatcccctgccccgcacgccgnnnnnggtgcacctggacgactcccccagcttctgcgtg
gctggccgcttctccccaggcactgccggccgcaggtgccaccgtgagaagaactgcgag
agcatctgctgcgggcgcggccacaacacacagagtcgggtggtgacccggccttgccag
tgccaggtgcgctggtgctgctacgtggagtgcaggcagtgcacccagcgggaggaggtc
tacacctgcaagggctga

KEGG   Bos indicus (zebu cattle): 109561268
Entry
109561268         CDS       T04792                                 

Gene name
WNT8A
Definition
(RefSeq) protein Wnt-8a
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109561268 (WNT8A)
   04390 Hippo signaling pathway
    109561268 (WNT8A)
   04150 mTOR signaling pathway
    109561268 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109561268 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109561268 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561268 (WNT8A)
   05205 Proteoglycans in cancer
    109561268 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109561268 (WNT8A)
   05226 Gastric cancer
    109561268 (WNT8A)
   05217 Basal cell carcinoma
    109561268 (WNT8A)
   05224 Breast cancer
    109561268 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109561268 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    109561268 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109561268 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109561268 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109561268 (WNT8A)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109561268 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 109561268
NCBI-ProteinID: XP_019819210
UniProt: A0A6P5C163
LinkDB
Position
7
AA seq 351 aa
MGDLLILRVAVGICYVTFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAW
ERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYTITKNCSMGDFENCGCDESKNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTC
KCHGISGSCSIQTCWLQLANFRELGNYLKAKYERALKIEMDKQQLRAGNSAEGHWIPTEA
FLPSAEAELIFLEESPDYCXRNSSLGIYGTEGRECLQNSRNTSRWEQCSCGRLCTECGLQ
VEERRTEAISSCNCKFQWCCTVKCEQCRHVVNKYYCTSSPGSAQSRGKGSA
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggggacctacttattctcagagtggctgtgggcatatgctatgtaaccttcagtgcc
tctgcttggtcagtgaacaatttcctgataacagggcccaaggcctatctgacctatacc
accagtgtggccctgggcgcccagagtggcatcgaggagtgcaaattccaatttgcttgg
gaacgttggaactgccctgaaaatgctctccagctctccactcacaacagrctaagaagt
gctaccagggagacttctttcattcacgctatcagctctgctggagtcatgtacaccatt
accaagaactgtagcatgggtgactttgaaaactgtggctgtgatgagtcaaaaaatggt
aaaacaggaggccatggctggatctggggaggttgtagtgacaatgttgaatttggggaa
agaatctccaaactctttgtggacagcctggagaaagggaaggatgccagagccctgatg
aatcttcataacaacagagcaggcaggctggcagtgagagccaccatgaagagaacttgc
aaatgtcacggcatctcaggcagctgtagcatccagacatgctggctacagctagctaac
ttcagggagttgggcaactacctaaaggccaagtacgaacgggcactgaaaattgagatg
gataaacagcagctaagggctgggaacagtgccgagggccactggatacccaccgaggcc
ttccttcctagtgcagaagctgagctgatctttttagaggaatcacctgattactgtwcc
cgcaattccagcttgggcatctatggcacagaaggtcgggaatgtctgcagaacagccgc
aacacatccagatgggagcaatgcagctgtgggcgcctgtgcacagaatgtggcctgcag
gtggaagagagaagaaccgaggctatcagcagctgtaactgcaaattccagtggtgctgc
actgtcaagtgtgagcagtgtcggcatgtggtgaacaagtactactgcacgagctcccca
ggcagtgctcagtcccggggcaagggcagtgcctga

KEGG   Bos indicus (zebu cattle): 109561352
Entry
109561352         CDS       T04792                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109561352 (WNT3A)
   04390 Hippo signaling pathway
    109561352 (WNT3A)
   04150 mTOR signaling pathway
    109561352 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109561352 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109561352 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561352 (WNT3A)
   05206 MicroRNAs in cancer
    109561352 (WNT3A)
   05205 Proteoglycans in cancer
    109561352 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109561352 (WNT3A)
   05226 Gastric cancer
    109561352 (WNT3A)
   05217 Basal cell carcinoma
    109561352 (WNT3A)
   05224 Breast cancer
    109561352 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109561352 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    109561352 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109561352 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109561352 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109561352 (WNT3A)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109561352 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 109561352
NCBI-ProteinID: XP_019819295
UniProt: A0A6P5C1E7
LinkDB
Position
7
AA seq 290 aa
MPSVAEGIKISIQECQHQFRGRRWNCTTINNSLAIFGPVLDKATRESAFVHAIASAGVAF
AVTRSCAEGSAAICGCSSRHQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDARSA
MNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMV
VEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSH
GIDGCDLLCCGRGXNARTEQRREKCHCVFHWCCYVSCQECARVYDVHTCK
NT seq 873 nt   +upstreamnt  +downstreamnt
atgcccagcgtggcagagggcatcaaaatcagcatccaggagtgccaacaccagttccgt
ggccgccgttggaattgcaccaccatcaacaacagcctggccatctttggccccgtgctg
gacaaagctactcgggagtccgccttcgtgcacgccatcgcctctgccggcgtagccttc
gcggtgacgcgctcttgcgccgagggctccgctgccatctgcggctgcagcagccgccat
cagggctcgcccggtgagggctggaagtggggcggctgcagcgaggacatcgagttcggc
gggatggtgtctcgggagttcgcagatgcgcgggagaaccgcccagacgctcgctccgcg
atgaaccgccacaacaatgaggctgggcgccaggccatcgccagtcacatgcacctcaag
tgcaagtgccatgggctctcgggcagctgtgaagtgaagacctgctggtggtcgcagcct
gacttccgcgccattggtgacttcctcaaggataagtatgacagcgcctcagagatggtg
gtggagaagcaccgcgagtcgcgcggctgggtggagaccctgcggccacgctacacttac
tttaaggtgcccacagagcgcgacctggtctactacgaggcctcgcccaacttctgtgag
cccaaccccgaaacaggatcattcggcacgcgagaccgcacctgcaacgtgagctcgcac
ggcatagacggctgcgacctgctgtgctgcggccgcggnnncaacgcgcgcaccgagcag
cggagggagaagtgccactgcgtcttccactggtgctgctatgtgagctgccaggagtgc
gcgcgcgtctacgacgtgcacacctgcaagtag

KEGG   Bos indicus (zebu cattle): 109569843
Entry
109569843         CDS       T04792                                 

Gene name
WNT11
Definition
(RefSeq) protein Wnt-11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109569843 (WNT11)
   04390 Hippo signaling pathway
    109569843 (WNT11)
   04150 mTOR signaling pathway
    109569843 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109569843 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109569843 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109569843 (WNT11)
   05205 Proteoglycans in cancer
    109569843 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109569843 (WNT11)
   05226 Gastric cancer
    109569843 (WNT11)
   05217 Basal cell carcinoma
    109569843 (WNT11)
   05224 Breast cancer
    109569843 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109569843 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    109569843 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109569843 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109569843 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109569843 (WNT11)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109569843 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 109569843
NCBI-ProteinID: XP_019831147
UniProt: A0A6P5D2A0
LinkDB
Position
15
AA seq 354 aa
MRARPQVCQALLFALALQTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTIVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELRDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELIYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSHGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtctgccaggcgctgctcttcgccctggcgctccagaccggc
gtgtgctatggcatcaagtggctggccctgtccaagaccccggcrgccctggcgctgaac
cagacgcagcactgcaagcagctggagggcctggtgtcagcgcaggtacagctgtgccgc
agcaacctggagctcatgcayaccatcgtgcacgccgcccgcgaggtcatgaaggcctgc
cgccgggccttcgccgacatgcgctggaactgctcctccatcgagctcgcccccaactat
ctgctcgacctggagagagggacccgggagtcagccttcgtgtatgcgctgtcggcggcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgcccggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgcgcctctctggaaatgaagtgtaagtgccatggggtatctggctcctgctccatc
cgcacctgctggaaggggctgcaggagcttcgggatgtggccgccgacctcaagacccgc
tacctgtcggccaccaaggtggtgcaccgacccatgggtacccgcaagcacttagtgccc
aaggacctggacatccgacctgtgaaggactcagagctcatctatctgcagagctcccct
gatttctgcatgaagaatgagaaggtgggctcacacgggacgcaggacaggcagtgcaac
aagacatcgcatggcagcgacagctgtgacctcatgtgctgtggacgcggctacaaccct
tacacagaccgcgtggtcgagcgttgccactgcaagtaccactggtgctgctacgtcacc
tgccgcaggtgcgagcgcaccgtggagcgctacgtctgcaagtga

KEGG   Bos indicus (zebu cattle): 109570782
Entry
109570782         CDS       T04792                                 

Gene name
WNT6
Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109570782 (WNT6)
   04390 Hippo signaling pathway
    109570782 (WNT6)
   04150 mTOR signaling pathway
    109570782 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109570782 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109570782 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570782 (WNT6)
   05205 Proteoglycans in cancer
    109570782 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109570782 (WNT6)
   05226 Gastric cancer
    109570782 (WNT6)
   05217 Basal cell carcinoma
    109570782 (WNT6)
   05224 Breast cancer
    109570782 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109570782 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    109570782 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109570782 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109570782 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109570782 (WNT6)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109570782 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 109570782
NCBI-ProteinID: XP_019832525
UniProt: A0A6P5D3T2
LinkDB
Position
2
AA seq 365 aa
MQPPAPSRLGLLLLLLLSPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPPGLPGTPGPPGPAGXXXXXANREWGGCGDDVDFGD
EKSRLFMDAQHKRGRGDIRMLVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVLLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgcagccgcccgcgccctcccgcctggggctgctcctgctgctgctcctgagtccggcg
cacgtcggcggactgtggtgggccgtgggcagccctttggtcatggaccctaccagcatc
tgcaggaaggcccggcggctcgcagggcggcaggctgagttgtgccaggccgagccagaa
gtggtggccgagctagcgcgrggcgcccggctgggggttcgggaatgccagttccagttc
cgcttccgacgctggaactgctccagccatagcaaggccttcgggcgcatcctgcaacag
gacatccgggagacggccttcgtgttcgctataacggcggcaggcgccagccatgcggtc
acgcaggcctgctccatgggcgagctgctgcagtgcggctgccaggcgccccgaggccgg
gccccaccccgaccccccggcctgccaggcacccctgggccccccggccccgcgggannn
nnnnnnnnnnnngctaacagggagtggggaggctgcggcgacgacgtggacttcggggac
gagaagtcgaggctcttcatggacgcgcagcacaaacggggacgtggagacatccgtatg
ttggtgcaacttcataacaacgaggcgggccggctggcagtgcggagccacacgcggacc
gaatgcaagtgccacgggctgtccggctcgtgcgcgctgcgcacctgctggcagaagctg
cccccgttccgcgaggtgggcgcgcggttgctcgagcgcttccacggcgcctcgcgtgtc
atgggcaccaacgatggcaaggctctgctgcccgccgtccgcacgctcaagccgccgggc
cgcgctgacctgctctatgccgccgactcgcccgacttctgcgcccccaaccggcgcacg
ggttcgccgggcacccgcggccgcgcctgcaacagcagcgccccggacctcagcggctgc
gacctgctgtgctgcggccgcgggcaccgccaggagagcgtgcttctcgaggagaactgc
ctgtgccgctttcactggtgctgcgtggtgcagtgccaccgctgccgcgtgcgcaaggag
ctcagcctttgcctttga

KEGG   Bos indicus (zebu cattle): 109570791
Entry
109570791         CDS       T04792                                 

Gene name
WNT10A
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109570791 (WNT10A)
   04390 Hippo signaling pathway
    109570791 (WNT10A)
   04150 mTOR signaling pathway
    109570791 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109570791 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109570791 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570791 (WNT10A)
   05205 Proteoglycans in cancer
    109570791 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109570791 (WNT10A)
   05226 Gastric cancer
    109570791 (WNT10A)
   05217 Basal cell carcinoma
    109570791 (WNT10A)
   05224 Breast cancer
    109570791 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109570791 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    109570791 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109570791 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109570791 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109570791 (WNT10A)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109570791 (WNT10A)
SSDB
Motif
Pfam: wnt Ebola_NP
Other DBs
NCBI-GeneID: 109570791
NCBI-ProteinID: XP_019832534
UniProt: A0A6P5D4Z2
LinkDB
Position
2
AA seq 417 aa
MGSTHPCPWLRLRPRPQPRPALCALLFFLLLLAASVPRSAPNDILGLRLPQEPVLNANTV
CLTLPGLSKRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAISAAGVVHAVSNACALGKLRACGCDASRRGDEEAFRRKLHRLQLE
ALQRGKGLSHGVPEHPALPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRSRFHRATLI
RPHNRNSGQLEPGPAGAPSPAPGLPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGPDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcactcacccttgcccctggctgcggctccgacctcggccccagccgcggccc
gcgctctgcgctctcctcttcttcctactgctgctggctgcctccgtgcccaggtctgca
cccaacgatatcctgggcctccgcctcccccaggagcccgtgctcaacgccaacacggtg
tgcctgacattgccaggcctgagcaagcggcagatggaggtgtgtgtgcgccaccctgac
gtggctgcttcagccatccagggcatccagattgccatccatgagtgccagcaccagttc
cgggatcagcgctggaattgctctagtctggagactcgaaacaagatcccttatgagagt
cccatcttcagcagaggtttccgagaaagtgcattcgcctacgccatctcggcagccggc
gtggtgcacgcggtatccaacgcctgcgccctgggcaaactgagggcctgcggctgcgac
gcatcccggcgtggcgacgaggaggccttccgtcggaagttgcaccgcctgcagctggaa
gcgctgcagcgcggcaagggcctgagccacggagttcccgagcaccctgccctgcccccg
gccagccccggcctgcaggactcctgggagtggggcggctgcagccctgacgtgggtttt
ggagagcgcttctctaaagactttctggactcccgggaacctcacagagacatccatgcg
cgcatgaggctccacaacaaccgagtagggaggcaggcggtgatggagaacatgcggcgg
aagtgcaagtgccatggcacgtcaggcagctgccagctcaagacttgctggcaggtgacg
cccgagttccgcgcggtgggggcgctgctgcgcagccgcttccaccgcgccacgctcatc
cgcccgcacaaccgcaacagcggacagctggagcccggtcccgcgggggcaccctcgccc
gccccgggacttccggggccacggcgccgcgccagccccgccgacctggtctacttcgag
aagtcgcccgacttctgcgagcgggagccgcgcctggactcggcgggcaccgtgggccgc
ctgtgcaacaagagcagtgcgggccctgatggctgcggcagcatgtgctgtggccgcggc
cacaacatccttcggcagacacgcagtgagcgctgtcactgccgcttccactggtgctgc
ttcgtggtctgtgaggagtgccgcatcactgagtgggtcagtgtctgcaagtga

KEGG   Bos indicus (zebu cattle): 109573450
Entry
109573450         CDS       T04792                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109573450 (WNT3)
   04390 Hippo signaling pathway
    109573450 (WNT3)
   04150 mTOR signaling pathway
    109573450 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109573450 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109573450 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109573450 (WNT3)
   05206 MicroRNAs in cancer
    109573450 (WNT3)
   05205 Proteoglycans in cancer
    109573450 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109573450 (WNT3)
   05226 Gastric cancer
    109573450 (WNT3)
   05217 Basal cell carcinoma
    109573450 (WNT3)
   05224 Breast cancer
    109573450 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109573450 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    109573450 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109573450 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109573450 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109573450 (WNT3)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109573450 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 109573450
NCBI-ProteinID: XP_019836231
UniProt: A0A6P5DDB0
LinkDB
Position
19
AA seq 355 aa
MEPHLLRLLLGLLLCGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctccggctgctcctcggcctcctgctctgtggcaccagggtcctc
gccggctacccaatttggtggtccctggcactgggccagcagtacacatccctgggctca
cagcccctactctgcggctccatcccaggcctggtccccaagcagctgcgcttctgccgc
aattacatcgaaatcatgcccagcgtggccgagggcgtgaagctgggcatccaggagtgc
cagcaccagtttcggggccgccgctggaactgcaccaccatcgacgacagcctggccatc
ttcgggcccgtcctcgacaaagccacccgggaatcggccttcgtgcacgccatcgcctca
gccggtgtggccttcgcagtcacgcgctcctgtgcggagggtacctccaccatctgtggc
tgcgactcacatcataaggggccgcctggcgagggctggaaatggggcggctgcagcgag
gatgctgacttcggggtgcttgtgtcccgagagttcgcagatgcacgcgagaacaggcca
gacgcgcgctcggccatgaacaagcacaacaacgaggctggccgtacgaccatcctggac
cacatgcatctcaagtgcaagtgccacgggctgtcaggcagctgtgaggtcaagacctgc
tggtgggcccagcccgacttccgcgccatcggcgacttcctcaaggacaagtatgacagc
gcctcggagatggtggtggagaagcatcgggagtcccgcggctgggtggagaccctccgc
gccaagtatgcgctcttcaagccgcccacggagagggacctggtctactacgagaactcg
cccaacttttgcgagcccaaccccgagacgggctccttcggtaccagggaccggacttgc
aatgtcacctcccacggcatcgacggctgtgacctgctctgctgcggccgcggccacaac
acgaggacggagaagcggaaggagaagtgtcactgcatcttccactggtgttgctacgtg
agctgccaggagtgtatccgcatctatgacgtgcacacctgcaagtag

KEGG   Bos indicus (zebu cattle): 109576138
Entry
109576138         CDS       T04792                                 

Gene name
WNT4
Definition
(RefSeq) protein Wnt-4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04919  Thyroid hormone signaling pathway
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109576138 (WNT4)
   04390 Hippo signaling pathway
    109576138 (WNT4)
   04150 mTOR signaling pathway
    109576138 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109576138 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109576138 (WNT4)
   04916 Melanogenesis
    109576138 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    109576138 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109576138 (WNT4)
   05205 Proteoglycans in cancer
    109576138 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109576138 (WNT4)
   05226 Gastric cancer
    109576138 (WNT4)
   05217 Basal cell carcinoma
    109576138 (WNT4)
   05224 Breast cancer
    109576138 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109576138 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    109576138 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109576138 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109576138 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109576138 (WNT4)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109576138 (WNT4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 109576138
NCBI-ProteinID: XP_019840118
UniProt: A0A6P5DNZ1
LinkDB
Position
2
AA seq 494 aa
MGLLGEEYRASKALSSMDTQTLYISSTLHVVYLHCDQIERTLWIPDLFLLAVPSLAPQVP
HLEETQRPTASEQRLPPRRRASASALHPPPRALGSEPGPGHPLLLPEVPCVCTLISAPTM
PGNPSGAAELPDLVASQKRGFRFRQSPATVPSCPKHGEAPSSSRKAGGRYLAKLSSVGSI
SEEETCEKLKGLIQRQVQMCKRNLEVMDSVRQGAQLAIEECQYQFRNRRWNCSTLDSLPV
FGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSD
NIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEV
KTCWRAVPPFRQVGHALKEKFXXXXXXXXXXXXXXXXXVPRNAQFKPHTDEDLVYLEPSP
DFCEQDVRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVK
CRQCQRLVELHTCR
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggggctcctgggagaggagtacagggcatccaaggctctgagctccatggacacgcag
accctctacatctctagcaccttgcatgtggtttatcttcactgcgaccaaatagagagg
accttatggatcccagatctgttcctcctggcagtcccttctcttgcgccccaggttcct
catctggaggaaacacagaggcccacagccagtgagcagcgcctcccgccccggcggagg
gcctcagcctcagccctccacccgccccctagggcactcggatccgagccgggccctggc
caccctctgctgctcccggaagtgccctgtgtctgcaccttgatctccgcacccacgatg
ccaggaaaccccagtggggcggccgagctgccggatcttgtggccagccagaagcgaggt
ttcagattccggcagtctccggccactgtcccaagctgcccgaagcatggggaggccccg
tccagctcccggaaggctggagggaggtacctggccaagctgtcgtcggtgggaagcatc
tccgaggaggagacctgcgagaagctcaagggcctgatccagaggcaggtacagatgtgc
aagcgaaacctggaggtgatggactcggtgcgccaaggcgcccagctcgccatcgaggag
tgccagtaccagttccggaaccggcgctggaactgctccacgctcgactcgctgccggtc
ttcggcaaggtggtgacgcaagggactcgggaggcggccttcgtgtacgccatctcttcg
gcaggtgtggcctttgcggtgacgcgggcgtgcagcagcggggagctggagaagtgcggc
tgtgaccggaccgtgcacggggtcagcccgcagggcttccagtggtcaggatgctcagat
aacatcgcctatggggtggccttctcccagtcattcgtggacgtccgtgagaggagcaag
ggggcctcgtccagccgggccctcatgaacctccacaacaacgaggctggcaggaaggct
atcctgacacacatgcgggtggagtgcaagtgccacggggtgtcgggctcctgcgaggta
aagacgtgctggcgagccgtgccgcccttccgccaggtgggccacgccctgaaggagaag
ttcgannnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnaggtgccg
cgcaacgcgcagttcaagccgcacacggatgaggacctggtgtacctggaacccagcccg
gacttctgcgagcaggacgtgcgcagcggcgtgctgggcacgcggggccgcacgtgcaac
aagacgtccaaggccattgacggctgcgagctgctgtgctgcggccgtggcttccacacg
gcgcaggtggagctggccgagcgctgcagctgcaagttccactggtgctgctttgtcaaa
tgccggcagtgccagcggctggtggagctacacacgtgccggtga

KEGG   Bos indicus (zebu cattle): 109576252
Entry
109576252         CDS       T04792                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109576252 (WNT5A)
   04390 Hippo signaling pathway
    109576252 (WNT5A)
   04150 mTOR signaling pathway
    109576252 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109576252 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109576252 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    109576252 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109576252 (WNT5A)
   05205 Proteoglycans in cancer
    109576252 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109576252 (WNT5A)
   05226 Gastric cancer
    109576252 (WNT5A)
   05217 Basal cell carcinoma
    109576252 (WNT5A)
   05224 Breast cancer
    109576252 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109576252 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    109576252 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109576252 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109576252 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109576252 (WNT5A)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109576252 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 109576252
NCBI-ProteinID: XP_019840362
UniProt: A0A6P5DTP3
LinkDB
Position
22
AA seq 380 aa
MKKSIGILSPGVAWGTAGRAMSSKFFLMALAIFLSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYSLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagtcgattggaatattaagcccaggagttgcttgggggacggctggaagggca
atgtcttccaagttcttcctaatggctttggccatatttctctccttcgcccaggttgta
atagaagctaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatatcataggagcgcagcctctctgcagccaactggcaggactttcccaaggacagaag
aaactctgccacttgtatcaggaccacatgcagtacattggagagggcgccaagacgggc
atcaaggagtgccagtatcagttccggcaccggaggtggaactgcagcaccgttgataac
acctctgtcttcggcagggtcatgcagatcggcagccgcgagacggccttcacgtacgcg
gtgagcgccgcgggggtggtcaacgccatgagccgcgcctgccgcgagggcgagctgtcc
acctgcggctgcagccgcgccgcgcgccccaaggacctgccgcgggactggctgtggggc
ggctgcggcgacaacatcgactacggctaccgcttcgccaaggagttcgtggacgcccgc
gagcgggagcgcatccacgccaagggctcgtacgagagcgcgcgcatcctgatgaacctg
cacaacaacgaggccggccgccggacggtgtacagcctggccgaygtggcctgcaagtgc
cacggggtgtcaggctcgtgcagcctcaagacgtgctggctgcagctggccgacttccgc
aaggtgggtgatgccctgaaggagaagtacgacagcgcggcggccatgcggctcaacagc
cggggcaagctggtgcaggtcaacagccgcttcaactcgcccacyacccaggacctggtc
tacatcgaccccagccccgactactgcgtgcgcaacgagagcaccggctcgctgggcacg
cagggccgcctgtgcaacaagacgtccgagggcatggacggctgcgagctcatgtgctgc
ggccgcggctacgaccagttcaagacggtgcagacygagcgctgccactgcaagttccac
tggtgctgctacgtcaagtgcaagaagtgcacggagatcgtggaccagttygtctgcaag
tag

KEGG   Bos indicus (zebu cattle): 109576501
Entry
109576501         CDS       T04792                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109576501 (WNT7A)
   04390 Hippo signaling pathway
    109576501 (WNT7A)
   04150 mTOR signaling pathway
    109576501 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109576501 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109576501 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109576501 (WNT7A)
   05205 Proteoglycans in cancer
    109576501 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109576501 (WNT7A)
   05226 Gastric cancer
    109576501 (WNT7A)
   05217 Basal cell carcinoma
    109576501 (WNT7A)
   05224 Breast cancer
    109576501 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109576501 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    109576501 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109576501 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109576501 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109576501 (WNT7A)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109576501 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 109576501
NCBI-ProteinID: XP_019840714
UniProt: A0A6P5DS65
LinkDB
Position
22
AA seq 349 aa
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPAFLKIKKPLSYRKPMDTELVYIEKSPSYCEEDPATGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEVYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctcggtggtagctctgggcgcaagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcgcaaatgggcctggacgagtgtcagtttcaattccgcaacggc
cgctggaactgctcggcactgggggagcgcactgtcttcggcaaggagctcaaagtgggg
agccgggaggccgccttcacctacgccatcatcgccgcgggcgtggcccacgccatcacg
gcggcctgcacccagggcaacctgagcgactgcggctgcgacaaggagaagcagggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaaacagaacgcccggactctcatg
aacttacacaataatgaggcaggccggaagatcctggaggaaaacatgaagctggagtgc
aagtgccacggcgtgtcgggctcctgcaccacgaagacctgctggaccacgctgccgcag
ttccgcgagctgggctaygtgctcaaggacaagtacaacgaggcggtccacgtggagccc
gtgcgcgccagccgcaacaagcggcccgccttcctcaagatcaagaagccgctgtcctac
cgcaagcccatggacactgagctggtgtacatcgagaagtcgcccagctactgcgaggag
gacccggcgacgggcagcgtgggcacgcagggccgcgcctgcaacaagacggcgccccag
gccagcggctgcgacctcatgtgctgcggccgcggctacaacacccaccagtacgcccgc
gtgtggcagtgcaactgcaagttccactggtgctgctacgtcaagtgtaacacgtgcagc
gagcgcaccgaggtctacacgtgcaagtga

KEGG   Bos indicus (zebu cattle): 109578990
Entry
109578990         CDS       T04792                                 

Gene name
WNT8B
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109578990 (WNT8B)
   04390 Hippo signaling pathway
    109578990 (WNT8B)
   04150 mTOR signaling pathway
    109578990 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109578990 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109578990 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109578990 (WNT8B)
   05205 Proteoglycans in cancer
    109578990 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109578990 (WNT8B)
   05226 Gastric cancer
    109578990 (WNT8B)
   05217 Basal cell carcinoma
    109578990 (WNT8B)
   05224 Breast cancer
    109578990 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109578990 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    109578990 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109578990 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109578990 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109578990 (WNT8B)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109578990 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 109578990
NCBI-ProteinID: XP_019843997
UniProt: A0A6P5E3W6
LinkDB
Position
26
AA seq 328 aa
MSLSLTXVSLQAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANR
ETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAIS
KQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFRE
VGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLG
LLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQ
CRRRVTKYFCSRADRPRGGAAHEPGRKP
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtcgctgagtttgaccyctgtgtccctgcaggcttacctgatctactccagcagcgtg
gcagctggtgcccagagtggaattgaagaatgcaaatatcagtttgcttgggaccgctgg
aactgccctgagagagccctgcagctgtccagccatggtggccttcgcagtgctaatcgg
gagacagcatttgtacatgccatcagttctgctggggtcatgtacactctgactagaaac
tgcagccttggggattttgacaactgtggctgtgacgactcccgcaatgggcaactgggg
ggccaaggctggctgtggggaggctgcagcgacaacgtgggcttcggagaggcaatatcc
aagcagttcgtcgatgccctggagacaggacaggatgctcgggcagccatgaacctgcac
aacaatgaggcaggccgcaaggcggtgaagggcaccatgaaacgcacgtgtaagtgccac
ggggtgtctggcagctgcaccacgcagacctgctggctgcagctgccggagttccgagag
gtgggcgcgcacctgaaagagaagtaccacgcagctctcaaggtggacctgctgcagggt
gcaggcaatagcgcggcgggccgcggcgccatcgctgacacctttcgctccatctccacg
cgggagctggtgcacctggaggactccccggactactgcctggagaacaagacgctaggg
ctgctgggcaccgaaggcagagagtgcctgcggcgcggccgggccctgggccgctgggag
cgccgcagctgccgtcgactctgcggggactgcgggctggcggtagaggagcgccgcgcc
gagaccgtgtccagttgcaactgcaagtttcactggtgctgcgcggtccgctgcgagcag
tgccgccggcgagtcaccaagtacttctgcagccgcgcggaccggccacgtgggggcgcg
gcgcacgaacctgggagaaaaccctaa

DBGET integrated database retrieval system