KEGG   Bos indicus (zebu cattle): 109555962
Entry
109555962         CDS       T04792                                 

Gene name
CSF1
Definition
(RefSeq) macrophage colony-stimulating factor 1 isoform X1
  KO
K05453  macrophage colony-stimulating factor 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04151  PI3K-Akt signaling pathway
biu04380  Osteoclast differentiation
biu04640  Hematopoietic cell lineage
biu04668  TNF signaling pathway
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109555962 (CSF1)
   04014 Ras signaling pathway
    109555962 (CSF1)
   04015 Rap1 signaling pathway
    109555962 (CSF1)
   04668 TNF signaling pathway
    109555962 (CSF1)
   04151 PI3K-Akt signaling pathway
    109555962 (CSF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109555962 (CSF1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109555962 (CSF1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109555962 (CSF1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109555962 (CSF1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    109555962 (CSF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109555962 (CSF1)
   05022 Pathways of neurodegeneration - multiple diseases
    109555962 (CSF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109555962 (CSF1)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109555962 (CSF1)
SSDB
Motif
Pfam: CSF-1
Other DBs
NCBI-GeneID: 109555962
NCBI-ProteinID: XP_019812444
UniProt: A0A6P5BNK4
LinkDB
Position
3
AA seq 554 aa
MTARGAAGRCPPTTWLGPLLLLACLLVSNGATEEVSENCSHMIGNGHLLFLQQLIDSQME
TSCQISFEFVDQEQLDDPVCYLKKAFLLVQDIMEDTMRFKDNTPNAKVIVQLQELSLRLK
SCFTMDYDEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNIFSKNCNNSFAKCSS
HDVVTKPDCNCLYPKATPSSDLASVSPQQSPTPSTAPMAGLTWADSEATDGSSLLPREQA
LRTVDPGSAKQRPPRSTCQSFESPETPRVEGRPTGDSPQPGPSVGAPVTGMEDVLDSLLG
ANIALEEASGEASEGPIPQGAELSFYSLGGRSVQAEPASPSHTPPASSALSGSGKGLRLV
DATSAHLPTLGPMRPTEAWSHTPEKTERPSASPRDHQEPDMAXTPALHPQGLSSPSALSS
QPKLPRSHSWGHVLSLGELEGRRSTRDRRSLAELKGGQASEGAARPPARFNSVPLTDTGH
ERQHKEASDPQLPGFVFRLLVPSIILVLLAVGGLLFYRRRRRSHQEPQMVDSPMEQPEGS
LLTQEEDRQEELPV
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgaccgcgcggggcgccgccgggcgctgccctcccacgacatggctgggccctctgctg
ctgctggcctgtctcctggtgagcaatggtgctactgaggaggtgtcggagaactgtagc
cacatgattgggaacggacacctgctgttcctgcagcagctgattgacagtcagatggag
acctcgtgccaaatttccttcgagtttgtagaccaggagcagttggatgatcccgtgtgc
taccttaagaaggcatttctcctggtgcaagacataatggaggataccatgcgcttcaaa
gacaacacccccaatgccaaagtcatcgtccagctccaggaactctctctgaggctgaag
agctgcttcaccatggactatgatgagcaggacaaggcttgtgtccgaacattccatgag
acgcctctccagttgctggagaagatcaagaatgtctttaatgaaacaaaaaatctcctt
aaaaaggactggaacattttcagcaagaactgcaacaacagctttgctaaatgctccagc
catgatgtggtgaccaagcctgattgcaactgcctgtaccccaaagccacccctagcagt
gacctggcctctgtctcccctcagcagtcccccaccccctccacagcccctatggctggc
ttgacctgggctgactctgaggcaacagacggcagctccctcttgcccagagagcaggcc
cttcgcacagtggacccgggcagtgccaagcagcgaccacccaggagcacctgccagagc
tttgagtcgccagagaccccacgcgttgagggccgccccactggagattctcctcagccc
ggcccttcggttggagcccctgtcactgggatggaagacgttcttgactctctgctgggt
gctaacatagccctggaagaggcctccggagaggctagtgagggtcctataccccaaggg
gcagagctttccttctacagtctgggaggacgcagtgtccaggcagagcctgccagcccc
agtcacacccccccagcatcttcagcactctctggatcaggaaaggggctgcggcttgtg
gatgcaactagcgcacacctgcccacactgggccccatgagacccactgaggcctggagt
cacacgcctgagaagacagaacgtccctctgcctcgcccagagaccaccaggagccagac
atggccargaccccagcactgcacccgcaaggcctcagcagtccctccgccctctcttct
cagccaaagctccccagaagycactcctggggccacgtgctgtcccttggggagctggaa
ggcaggaggagcaccagggaccggaggagtcttgcagagctgaaaggaggacaagcaagt
gagggggcggccaggcccccagcccgttttaactccgttcctttgactgacacaggccac
gagaggcagcacaaggaagcctccgatccccagctccctggttttgtcttccgcctgctg
gtgcccagtatcatcctggtcttgctggctgtcggcgggctcctgttctacaggcggcgg
cgtcggagccatcaagagccacagatggtggattctcccatggagcaaccagagggcagc
ctcctgacccaggaagaggayagacaggaggagctgccagtgtag

DBGET integrated database retrieval system