KEGG   Bos indicus (zebu cattle): 109556162
Entry
109556162         CDS       T04792                                 

Gene name
TFRC
Definition
(RefSeq) transferrin receptor protein 1 isoform X1
  KO
K06503  transferrin receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04066  HIF-1 signaling pathway
biu04144  Endocytosis
biu04145  Phagosome
biu04216  Ferroptosis
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    109556162 (TFRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109556162 (TFRC)
   04145 Phagosome
    109556162 (TFRC)
  09143 Cell growth and death
   04216 Ferroptosis
    109556162 (TFRC)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109556162 (TFRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109556162 (TFRC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109556162 (TFRC)
   04090 CD molecules [BR:biu04090]
    109556162 (TFRC)
Peptidases and inhibitors [BR:biu01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   109556162 (TFRC)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109556162 (TFRC)
  Exosomal proteins of colorectal cancer cells
   109556162 (TFRC)
CD molecules [BR:biu04090]
 Proteins
  109556162 (TFRC)
SSDB
Motif
Pfam: Peptidase_M28 PA TFR_dimer DUF2367 Peptidase_G2
Other DBs
NCBI-GeneID: 109556162
NCBI-ProteinID: XP_019812823
UniProt: A0A6P5B2L5
LinkDB
Position
1
AA seq 842 aa
MPLLGGHAGHLPDISGAHDPPILLHGQGHCHLGCCTRRRLPGAPLPVAADPGHVGERGGA
LLRGQGSSVWQLRMMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAADEEEN
VDSNMRGNQTSIAKPKRLNGYVCYGIIAVIVFFLIGFMIGYLFKGRRVESQDCGKEAGTQ
PSCPEETETFESEEQLPGVPRIFWADLKSTLSGKLDAVDFARAIKMLNENSYVPREAGSE
KDTSLAFFIENQLQDCKLGKVWHDEHFIKIQVKGSSQNSVSIVSTSGNGSQAYPVESPEG
YVAYSKAATVTGKLVHANFGTKQDFEDLNMPVNGSLVIVRAGKISFAEKVANAESLNAIG
VLIYMDYSKYPIVNANLPVFGHAHLGTGDPYTPGFPSFNHTQFPPSQSSGLPNIPVQTIT
RAGAEKLFQNMEGDCPRIWGTDSSCKLVSSQDKNVKLSVNNVLKEIRILNVFGVIKGFEE
PDRYVIVGAQRDAWGPGAAKSSVGTSLLLTLARILSDMVLKGQFKPSRSIVFASWSGGDF
GAVGATEWLEGYLSSLHLKAFTYINLDKAVVGTTSFKVSASPLLYSLIEKIMKDVKHPLN
GLSLYRDSNWISKVQKLSLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTPMDTYETLNR
EVPQLNRVARAAAEVAGQLVIKLTHGVELNLNYEMYNDEILRFVKEMNLFRADIRDMGLN
MQWLYSARGDFFRATSRLTTDYKNAEKTDRSVMREINDRIMKVEYHLLSPYVSPREFPFR
HIFWGSGSHTLSALLEHLKLRKKNNGAFNQTLLENQLALATWTIQGAANALSGDIWDIDN
EF
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgcctctactcgggggccatgctggtcacctgcctgatatttctggtgcgcacgaccca
cctatccttctccatggacaaggccattgccatcttggttgctgtacccgccgccggctt
cctggtgcccctcttcctgttgctgctgatccaggccatgtcggtgagcgcggcggagcg
ctcctacgagggcaaggctcttctgtgtggcagctcagaatgatggatcaagccagatca
gcattctctaacttgtttggtggagaaccattgtcatataccaggtttagtctggctcgg
caagtagatggtgataacagtcatgtggagatgaaattagctgcagatgaagaagaaaat
gttgacagtaacatgaggggcaaccaaaccagtatcgcaaaaccgaaaaggttaaatgga
tatgtctgctacgggatcattgctgtaatcgtctttttcttgattggatttatgattggc
tacttgtttaaaggtagacgtgtggaatcacaagattgtgggaaagaggcaggaacacag
ccttcgtgcccagaggagacagaaactttcgaatcagaagagcaactccctggagtacct
cgcatattctgggcagacctcaaatcaacgttgtcaggaaaactggatgccgtagacttt
gccagggccatcaagatgctgaatgaaaattcttatgtcccacgtgaagctggatctgaa
aaagataccagtttggcttttttcattgaaaatcaattacaggactgtaaactcggcaaa
gtctggcatgatgaacattttattaagattcaggtcaaaggcagttctcaaaactcggtg
tctatagtaagtacaagcggtaatggcagtcaggcatacccagtggagagtcctgagggt
tacgtggcatatagtaaggctgcgaccgttactggcaaactggtccatgctaattttggc
actaaacaagactttgaggatttaaatatgcctgtaaatggatctttagtgattgtaaga
gctggaaaaatcagttttgctgaaaaggtggcaaatgctgaaagtttaaatgcaattggt
gtcttgatatacatggactacagtaaatatcccattgttaatgcaaatcttccagttttt
ggacatgctcatctgggaacaggtgacccttacacacctggattcccttcttttaatcac
actcaatttccaccatctcagtcatcaggattgcccaacatacctgtccaaacaattacc
agagccggtgcagaaaagctatttcaaaatatggaaggagactgtcctcgtatttgggga
acagactcttcatgtaagctggtatcctcacaggataagaatgtgaaacttagcgtgaac
aatgtgctgaaggagataagaattcttaacgtctttggagttattaagggctttgaagaa
ccagatcgctatgttatagtaggggcccagagggatgcctggggtcctggagctgcaaag
tccagtgtaggaacaagtctgctattgacacttgcccggatactttccgatatggtctta
aaaggtcagtttaaacccagcagaagcattgtctttgccagctggagtggtggagacttt
ggagccgttggtgccactgaatggctagagggatacctttcctcattgcatttaaaggct
ttcacttacattaatctggataaagctgttgttggtactaccagtttcaaagtttctgcc
agcccactgttgtattcacttattgagaaaatcatgaaagatgtgaagcatccacttaat
gggctgtctctgtatcgggatagcaactggatcagcaaagtgcaaaaactttctttggat
aatgctgctttccctttccttgcatattctggaatcccagcggtctctttctgtttttgt
gaggacaccgattacccttatttaggcactcccatggacacctatgagacactgaacaga
gaagttcctcagttgaacagagtggcacgtgcagcagcagaagtggccggtcagcttgtg
attaaacttacccatggggttgagctgaacctgaactacgagatgtataatgacgaaata
cttcggtttgtgaaggaaatgaacctattcagagcagacataagggatatgggtctgaat
atgcagtggctgtattctgctcgtggagacttcttccgtgctacgtctagactaactacg
gattataagaatgctgagaaaacagacagatctgtgatgagggaaatcaatgaccgtatc
atgaaagtggaatatcacctcctctcaccctatgtatctccaagagagtttcctttccga
cacatcttctggggctctggctctcacactctgtcagctttactggagcacttgaagctg
cgtaagaaaaataatggtgcttttaatcaaacactgttggaaaaccagttggctctggca
acttggactattcagggagccgcaaatgccctctctggggacatttgggacattgacaac
gaattttaa

DBGET integrated database retrieval system