KEGG   Bos indicus (zebu cattle): 109556202
Entry
109556202         CDS       T04792                                 

Gene name
JAK1
Definition
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04621  NOD-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05212  Pancreatic cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109556202 (JAK1)
   04151 PI3K-Akt signaling pathway
    109556202 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109556202 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109556202 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109556202 (JAK1)
   04658 Th1 and Th2 cell differentiation
    109556202 (JAK1)
   04659 Th17 cell differentiation
    109556202 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109556202 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109556202 (JAK1)
   05203 Viral carcinogenesis
    109556202 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109556202 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109556202 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109556202 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109556202 (JAK1)
   05161 Hepatitis B
    109556202 (JAK1)
   05160 Hepatitis C
    109556202 (JAK1)
   05171 Coronavirus disease - COVID-19
    109556202 (JAK1)
   05164 Influenza A
    109556202 (JAK1)
   05162 Measles
    109556202 (JAK1)
   05168 Herpes simplex virus 1 infection
    109556202 (JAK1)
   05163 Human cytomegalovirus infection
    109556202 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109556202 (JAK1)
   05169 Epstein-Barr virus infection
    109556202 (JAK1)
   05165 Human papillomavirus infection
    109556202 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109556202 (JAK1)
   05140 Leishmaniasis
    109556202 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109556202 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109556202 (JAK1)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     109556202 (JAK1)
Protein kinases [BR:biu01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   109556202 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2
Other DBs
NCBI-GeneID: 109556202
NCBI-ProteinID: XP_019812878
UniProt: A0A6P5B2T5
LinkDB
Position
3
AA seq 1158 aa
MQYLNIKEDCSAMAFCAKMRSSKKAEMNLEAPEPGVEVLFYLSDREPLRLGGGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRTVTVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKXPDATPLLDAXSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
RFHPNDSGNVLCYEVMVTGNLGIQWRQKPHIVPVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGIQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYTMSQLSFDRILKKDITQGEHLGRGTRTHIYSGT
LTDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQHMRKCWEFQPSNRTT
FQNLIEGFEALLRSMSNI
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcagtgccatggctttctgtgctaaaatgagg
agctccaagaaggcggagatgaatctggaggcccctgagccgggggtggaggtgctcttc
tacctgtcggatagggagcctctccggctgggcggtggagagtacacggcggaggagctg
tgcatccgggcggcgcaggagtgctgtatctctcctctgtgtcacaacctctttgccctg
tatgacgagaacaccaagctctggtatgctccgaatcgcaccgtcaccgtcgacgacaaa
acgtcactccggcttcactaccggatgaggttctatttcaccaactggcatgggaccaac
gacaatgaacaatcagtatggcgacattctccaaagaagcagaaaaacggctatgagaaa
aaaaagnttccagatgcaacacctctccttgacgccmgctcgctggagtatctgtttgct
cagggacagtatgatttggtcaaatgcctggctcccattcgagaccccaagacggagcag
gatgggcacgacattgagaacgagtgtcttgggatggccgtgctggccatctcccactac
gccatgatgaagaagatgcaattgccagaactccccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggattttctaaaggagtttaacaacaagaccatttgtgacagcagc
gtgtccacgcacgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggtgctgaaatatttgagacttccatgctactgatttcatcagaaaatgagatgaat
cggttccatccaaatgatagtggaaatgttctctgctatgaagtgatggtsactggaaat
cttggaatccagtggagacagaaaccacatattgttcctgttgaaaaggaaaaaaacaaa
ctgaaacggaaaaaactggaaaataaacacaagaaggatgaggaaaaaaacaaaatccga
gaagagtggaacaatttttcttacttccctgagatcactcacattgtaatcaaggagtct
gtggtcagcattaataagcaggacaacaaaaaaatggaactgaagctctcttcccacgag
gaggccttgtccttcgtgtccctggtcgatggctacttccggctcacggcagacgcccat
cactacctctgcactgacgtggctcccccattgatcgtccacaacatacagaatggctgt
catggtccaatctgcacggagtatgccatcaataagctgcggcaggaggggagcgaggag
gggatgtacgtgctgcggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgcttcgaaaagtctgaggtgctgggtatccagaaacagttcaagaactttcagattgag
gtgcagaagggccgctacagcctgcatggctcggaccgcagcttcccgagccttggggac
ctcatgagccacctaaagaagcagatcctgcgcacggacaacatcagctttgtgctgaag
cgctgctgccagcccaagccccgagaaatctccaatctgctggtggccaccaagaaagcc
caggagtggcagcctgtctacaccatgagccagctgagtttcgatcgaatcctcaagaaa
gatattacgcaaggcgagcaccttgggagaggcacgcggacacacatctactctgggacc
ctcacggattacaaggatgacgaagggacttctgaagagaagagaataaaagtcatcctg
aaggtcttagaccccagccacagggacatttctctggccttctttgaggcagccagcatg
atgaggcaggtctcccacaaacacatcgtgtacctctatggggtttgcgtccgagatgtg
gagaatatcatggtggaagagtttgtggaggggggacccctggacctcttcatgcatcgg
aaaagtgacgtcctcaccacaccctggaagtttaaagttgccaaacagctggccagcgcc
ctgagttacttggaggataaagacctggtccacggaaatgtgtgcactaaaaacctccty
ctggcccgcgagggcatcgacagtgagtgcggccccttcatcaagctcagtgaccctggc
atccccatcactgtgctctccaggcaagagtgcatagaacgaatcccctggattgctccc
gagtgtgttgaagactccaagaatctgagtgtggctgctgacaagtggagctttggaacc
acactctgggaaatctgctacaatggcgagatccccttgaaagacaagacgctgattgag
aaagagagattctatgaaagccggtgcaggccagtgaccccgtcttgtaaggagctagct
gacttgatgacccgctgcatgaactacgaccccaaccagagacccttcttccgagccatc
atgagagacatcaataagctggaggagcagaatccagacattgtatcagaaaaaaagcca
acaactgaagtggatcccacacattttgaaaagcggttcttaaagaggatccgtgacttg
ggagagggccactttgggaaggtcgagctctgcaggtatgaccctgagggggacaataca
ggggagcaagtggctgtcaaatccctgaagcccgagagtggagggaaccacatcgctgat
ctgaagaaggagattgaaatcttaagaaatctttatcatgagaacattgtgaagtataaa
ggcatctgcacagaagatggtggaaatggtattaagctcatcatggagtttctgccttca
gggagccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacagcaatta
aaatacgccgttcagatttgtaaggggatggactatctgggttctcggcagtacgttcac
cgggacttagcagcaagaaacgtcctcgtggagagtgagcaccaggtgaaaatcggggac
ttcggtctcaccaaagccatcgaaaccgataaggagtactacacagtcaaggacgaccgg
gacagccctgtgttttggtatgctccagaatgtttaattcagtgtaagttctatatcgcc
tctgatgtctggtctttcggagtgactctgcatgagctgcttacttactgtgattcagat
tccagtcccatggccttgttcctgaaaatgataggcccaactcatggtcagatgacggta
acaagactcgtgaatacattaaaagaaggaaaacgcttgccatgtccaccgaactgtcca
gatgaggtttatcaacatatgcgaaagtgttgggaatttcaaccatctaatcggacaacc
tttcagaaccttattgaaggatttgaagcacttctaagaagcatgagtaacatttaa

DBGET integrated database retrieval system