KEGG   Bos indicus (zebu cattle): 109556373
Entry
109556373         CDS       T04792                                 

Gene name
PTCH2
Definition
(RefSeq) protein patched homolog 2 isoform X1
  KO
K11101  patched 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04340  Hedgehog signaling pathway
biu05200  Pathways in cancer
biu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    109556373 (PTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109556373 (PTCH2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    109556373 (PTCH2)
SSDB
Motif
Pfam: Patched Sterol-sensing MMPL
Other DBs
NCBI-GeneID: 109556373
NCBI-ProteinID: XP_019813152
UniProt: A0A6P5BIA9
LinkDB
Position
3
AA seq 1214 aa
MARPPPLGELPPGYTPPARPATPQILAGSLKAPLWLRAYFQGLLFSLGCGIQRHCGKVLF
LGLLAFGALALGLRVAIIETDLEQLWVEVGSRVSQELEYTKEKLGEEAAYTSQMLIQTPR
QEGENVLTPEALDLHLQAALTASKVQVSLYGKSWDLNKICYKSGVPLIENGMIERMIEKL
FPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPEQLLAELGPFASLEGFRELLDK
AQVGQAYVGRPCLHPDDLHCPPSAPNHHSRQAPNVAQELSGGCHGFSHKFMHWQEELLLG
GMARDPQGQLLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQAGTVLQAWQRRFV
QLAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACVTMLRWDCAQ
SQGAVGLAGVLLVALAVASGLGLCALLGIAFNAATTQVLPFLALGIGVDDIFLLAHAFTE
APPGSPLQERTGECLRRTGTSVTLTSINNMVAFFMAALVPIPALRAFSLQAAIVVGCNFA
AVMLVFPAVLSLDLRRRHCRRLDVLCCFSSPCSARVIQILPQELGNGTVPVGVAHLTATV
QAFAHCEASSQHVVTILPPQAQLVPPPSDPLGSELFSPGGSTRDLLGQEEGTGQKAACKS
LPCARWNLAHFARSQFAPLLLQSHTKLSRLSPQAVVLVLFGALLGLSLYGATLVQDGLAL
TDVVPRGTKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPP
ATQAPRTWLHYYRSWLQGIQAAFDQDWASGRITRHSYRNGSEDGALAYKLLVQTGDAQEP
LDFSQLTTKKLVDKEGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDTT
GENLRIPAAQPLEFAQFPFLLRGLQKTADFVEAIEGARAACAEASQAGVHAYPSGSPFLF
WEQYLGLRRCFLLAVCILLLCTFLVCALLLLNPWTAALIVLVLAMMTVELFGIMGFLGIK
LSAIPVVILVASIGIGVEFTVHVALGFLTAQGSRNLRAARALERTFAPVTDGAISTLLGL
LMLAGSNFDFIVRYFFVVLTILTLLGLLHGLVLLPVLLSILGPPPEVVQMYKESAEVLSP
PAPQGGGLRWGVPSTLPQSFARVTTSMTVALHPPPLPGAYIHPASEEPTWSPAATPAANG
PSNLGPRGLCPATG
NT seq 3645 nt   +upstreamnt  +downstreamnt
atggctcggccgccacctctcggggagctgcccccgggctacacacccccagctcgacct
gcaacaccccagatcctagctgggagcctgaaggctccgctctggctccgtgcttacttc
cagggcctgctcttctctttgggctgcgggatccagagacactgtggcaaagtgctcttc
ctgggactgttggcctttggggccctagcactgggtctccgcgtggccatcattgagaca
gacctagaacagctctgggtggaagtgggcagccgggtgagccaggaactggaatacacc
aaggagaagctgggggaggaggctgcgtatacctcccagatgttgatacagaccccgcgc
caggagggggagaacgtcctcacgcccgaggcacttgacctccacctccaggcagccctc
accgccagtaaagtgcaagtatccctctatggaaagtcctgggatctgaacaaaatctgc
tacaagtcaggagttcccctaattgaaaatggaatgattgagcggatgattgagaagctg
tttccctgcgtgatcctcacccccctcgactgcttctgggagggagccaaactccaaggg
ggctctgcctacttgccgggccgcccagacatccagtggaccaacctggacccagagcag
ctgctggcrgagctgggcccctttgcctcccttgagggcttccgggagctgctagacaag
gcacaggtgggccaggcctacgtggggcggccctgtctgcaccctgacgacctccactgc
ccacccagtgcccctaaccatcacagcaggcaggctcccaacgtggctcaggagttgagt
gggggctgccatggcttctcccacaagtttatgcactggcaggaggagctgctgctggga
ggcatggccagagacccccaaggacagctgctgagggcagaggccctgcagagcaccttc
ctgctaatgagcccccgccagctctacgagcacttccgaggtgactaccagacgcatgac
atcggctggagcgaggagcaggccggcacggtccttcaggcctggcagcgacgctttgtg
cagctggcccaggaggccctgcccgagaacgcatcccagcagatccacgccttctcctct
accaccctggacgacatcctgcacgccttctctgaagtcagcgctgcccgtgtggtgggg
ggctacctgctcatgctagcctatgcctgtgtgacratgctgcggtgggactgtgcccag
tcccagggtgcagtgggcctcgctggtgtgctgctggtggccctggcagtggcctcgggc
ctggggctctgtgccctgttgggcatcgccttcaacgctgccactacccaggtgctgcct
ttcttggcactgggcatcggcgtggacgacatattcctgctggcacacgccttcacagag
gctccacctggcagccctctccaggagcgcacgggggagtgtctgcgacgcacaggcacc
agtgtcacactcacatccatcaacaatatggttgccttcttcatggccgccctagttccc
atccctgcactgcgggccttctccttgcaggcagccatagtggtgggctgcaactttgca
gccgtgatgcttgtcttcccagcggtcctcagcctggacctgcggcggcgccactgccgg
cgcctggatgtgctctgctgcttctctagcccctgctctgctcgggtgattcagattctg
ccccaggagctggggaatgggacggtaccagtgggtgttgcccacctgactgccacggtt
caagcctttgcccactgtgaagccagcagccaacatgtggtcaccatcttgcctccccaa
gcccagctggtgccgccaccttctgaccctttgggctctgagctcttcagcccaggaggg
tccacacgggaccttctagggcaggaggaggggacagggcagaaggcagcctgcaagtcc
ctgccctgtgcccgctggaatcttgcccatttcgcccgctctcagtttgcacccttgttg
ctccagtcccacaccaagcttagtcgcctttccccacaggctgtagtactggtacttttt
ggggctctcctgggcctgagcctctatggagcgaccttggtgcaggacggtctggccctg
actgatgtggtgccgcgcggcaccaaggagcatgccttcctgagcgcccagctcaggtac
ttctctctgtatgaggtggctctggtgacacagggtggctttgactacgcccactcccaa
cgcgccctctttgatctgcaccagcgcttcagttccctcaaggccgtgctgcccccaccg
gccacccaggcaccccgcacctggctgcactactaccgcagctggctacagggaatccag
gctgcatttgaccaggactgggcttctgggcgcatcacccgccactcataccgcaatggc
tctgaggatggggccctggcatacaagctgctcgtccagaccggggatgcccaggagcct
ctagatttcagccagctgaccaccaagaagctggtggacaaggaagggctgatcccaccc
gagctcttctacatggggctgaccgtgtgggtgagcagtgaccccctgggtctggcagcc
tcacaggccaacttctatcccccacctcctgagtggctgcatgacaagtatgacaccacg
ggggagaatcttcgcatcccggcggcccagcccttggagtttgcccagttccccttcctc
ctgcgcggcctccagaagactgcagacttcgtggaggccattgagggggcccgggcagcg
tgtgctgaggccagccaggccggggtgcatgcctaccccagcggctcccccttcctcttc
tgggagcagtacctgggcctgcggcgctgcttcctgctggcagtctgcatcctgctgctg
tgtactttcctcgtctgtgccctgctgctgctcaacccctggacggctgcgctcatagta
ctggtcctggcgatgatgactgtggagctctttggcatcatgggtttcctgggcatcaag
ctgagtgccatcccggtggtgattcttgtggcctccataggcatcggtgtcgagttcacc
gtccacgtggctctgggcttcctgaccgctcagggtagccggaacctgcgggctgcccgg
gccctggagcgcacatttgctccagtgaccgatggggccatctccacgttgctaggtctg
ctcatgcttgctggctccaactttgacttcatcgtaaggtacttctttgtggtgctgaca
atacttacactcctgggcctcctccatgggctcgtgctgctgccggtactgctgtccatc
ctgggccccccaccagaggtggtacagatgtacaaggagagcgcagaggtcctgagcccc
ccagctccgcagggaggagggctcaggtggggggtaccctccaccctgccccagagcttt
gccagagtgactacctccatgactgtggccctccacccacccccactgcctggtgcctac
atccacccagcctctgaggagcctacttggtcgcctgctgccacaccagctgccaatggc
cccagcaacctcgggcctaggggactgtgtccagccacggggtga

KEGG   Bos indicus (zebu cattle): 109563237
Entry
109563237         CDS       T04792                                 

Gene name
PTCH1
Definition
(RefSeq) protein patched homolog 1
  KO
K06225  patched 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04024  cAMP signaling pathway
biu04340  Hedgehog signaling pathway
biu04360  Axon guidance
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    109563237 (PTCH1)
   04024 cAMP signaling pathway
    109563237 (PTCH1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    109563237 (PTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109563237 (PTCH1)
   05205 Proteoglycans in cancer
    109563237 (PTCH1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    109563237 (PTCH1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 109563237
NCBI-ProteinID: XP_019822097
UniProt: A0A6P5CAD1
LinkDB
Position
8
AA seq 1276 aa
MGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVE
ELWVEVGGRVSRELNYTXQKIGEEAMFNPQLMIQTPKEEGANVLTTEALRQHLDSALQAS
RVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTA
YLLGKPPLQWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPA
TAPNKNATKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQL
MTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTT
LDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSRSQGAVGLAGVLLVALSVAAGLG
LCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGA
SVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDR
RLDIFCCFTSPCVSRVIQVEPQAYTETHDNTRYSPPPPYSSHGFAHETQITMQSTVQLRT
EYDPHTHVYYTTAEPRSEISVQPVTMAQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPP
CTRWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETR
EYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHKSFSNVKYVMLEENKQLPKMWLH
YFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKRR
LVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRLRIPAA
EPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICNNYTSLGLSSYPNGYPFLFWEQYIGLRH
WLLLSISVVLACTFLVCAVFLLNPWTAGIIVTVLALMTVELFGMMGLIGIKLSAVPVVIL
IASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFD
FIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVR
FAVPAGHTNNGSDSSDSEYSSQTTVSGISEELRHYEAQQGAGGPAHQVIVEATENPVFAX
STVVHPEPRHHPPSNPRQQSHLDSRTLPPGQPGQQPRRETPRECLRAPPYKPRRDAFEIS
TEGHSGPSNRDRTGPR
NT seq 3831 nt   +upstreamnt  +downstreamnt
atggggaaagctactggccggaaagcgccgctgtggctgcgagcgaagtttcaaagactc
ttatttaaactgggttgttacattcaaaaaaactgcggcaagttcttggttgtaggcctc
ctcatatttggggccttcgctgtgggattaaaggcagctaatctcgagaccaacgtggag
gagctgtgggtggaagttggtggacgagtaagtcgtgaattaaattatactygccagaag
attggagaagaggctatgtttaatcctcaactcatgattcagacccccaaggaagaaggt
gctaatgtcctgaccacagaagcgctccgacagcacctggactcggcgctccaggccagc
cgggtccatgtatacatgtataacaggcagtggaaattggaacatttgtgttataaatct
ggagaacttatcacagaaacaggttacatggatcagataatagagtatctttacccttgt
ttaattattacacctttggactgcttctgggaaggggcgaagttacagtctgggacggca
tacctactaggtaagcctcctttgcagtggacaaactttgaccctttggaattcctagaa
gagttaaagaaaataaactatcaagtggacagctgggaggaaatgctgaataaggctgaa
gttggtcatggttacatggaccggccctgcctcaatccagctgatccagactgtcccgcc
acagcccccaacaaaaatgcaaccaaacctcttgatatggcccttgttttgaatggtggg
tgtcatggattatccagaaagtatatgcactggcaggaggaactgattgtgggtggcaca
gtcaagaacagcactgggaagcttgtcagtgcccatgctctgcagaccatgtttcagtta
atgactcccaagcaaatgtatgaacacttcaagggttatgagtatgtctcgcacatcaac
tggaacgaggacaaggcagcagccatcctggaggcttggcaaaggacgtacgtggaggtg
gttcatcagagtgttgctcagaactccactcagaaggtgctttcctttaccacgacgacc
ctggatgacatcctcaagtccttctctgatgtcagcgtcatccgagtggccagcggctat
ttactgatgcttgcctatgcctgtttaaccatgctgcgctgggactgctccaggtcccag
ggtgccgtggggctggctggcgtcctgttggttgcgctgtcagtggctgcaggattgggc
ctgtgctcgctgatcgggatttcctttaacgctgcaacaactcaggttttgccgtttctc
gctcttggtgttggtgtggatgatgtctttcttctggcgcatgcatttagtgaaacggga
cagaataaaagaattccttttgaggacaggaccggggagtgcctcaagcgcacgggagcc
agtgtggccctcacctccatcagcaacgtcacagccttcttcatggccgcgttgatccca
attccygctctgcgggcgttctccctgcaggcggctgtagtagtggtgttcaattttgct
atggttctgctgatttttcctgcaattctcagcatggatttgtatcgacgtgaggacagg
agattggatattttctgctgtttcacaagcccctgtgtcagcagagtgattcaggttgaa
ccccaggcctacacagagactcacgataacacccgctacagccccccacccccctacagc
agccacggcttcgcccatgaaacccagatcaccatgcagtccacggtacagcttcgcaca
gagtacgacccccacacgcacgtgtactacaccactgccgagccacgctccgagatctct
gtgcagcccgtcaccatggctcaggacacactcagctgccagagccccgagagcaccagc
tccacaagggacctgctctcccagttctcggactccagcctccactgcctggagcccccc
tgcaccaggtggacrctttcatctttcgctgagaagcactatgctcctttcctcttaaaa
ccaaaagccaaggtcgtggtgatcttccttttcctgggcctgctgggggtcagcctttat
gggaccacccgagtgcgtgatgggctggatcttacagacattgtgcctcgggaaactaga
gaatatgactttattgctgcacagttcaaatacttttctttctacaacatgtatatagtc
actcagaaagcagattacccgaatatccagcacttactttatgaccttcataagagtttc
agtaatgtgaagtatgtcatgctggaagaaaataaacagcttcccaaaatgtggctgcac
tacttcagagactggctccaaggacttcaggatgcatttgacagtgactgggaaaccggg
aaaatcatgccaaacaattacaaaaatggatcggatgatggggtccttgcctacaaactc
ctggtacaaaccggcagccgtgataagcccattgacatcagtcagctgactaaacggcgc
ctggtggatgcagacggcatcattaaccccagtgctttctacatctacctgactgcttgg
gtcagcaacgaccctgtggcttatgccgcctcccaagccaacatccggcctcaccgtcct
gagtgggttcatgacaaagcygactacatgccagaaaccaggctgagaatccccgcggca
gagcccatcgaatatgctcagttccctttctacctcaacggcctgcgtgacacctcggac
ttcgttgaagccatcgaaaaagtcagaaccatctgcaataactacacgagcctggggctc
tccagctaccccaatggctaccccttcctcttctgggagcagtacattggcctccgccac
tggctcctcctgtccatcagcgtggtgctggcctgcacgttcctcgtgtgcgccgtcttc
ctcctgaacccctggacggccgggatcattgtgacagtcttggctttgatgacagttgag
ctctttggcatgatgggcctcattggaatcaagctgagtgccgtgcctgtggtcatcttg
attgcttccgtcggcattggagtggaattcactgttcatgtcgctctggcctttctaaca
gccattggtgacaagaaccgcagggctgtgcttgccctggagcacatgtttgcgcctgtt
ctcgatggtgccgtttccactctactgggagtgctgatgcttgcaggatctgaatttgat
ttcattgtcaggtacttctttgctgtcctggcaatcctaacaatcctgggtgttctcaat
ggactagttttgctgccagtccttttgtccttcttcggaccgtatcctgaggtgtctcca
gccaatgggctgaaccggctgcccacaccttctcctgagccaccccccagcgtggtccgg
tttgctgtgcccgccggtcacacaaacaacgggtctgattcctctgactcggagtacagt
tctcagacgaccgtgtcaggcatcagtgaggagctgcggcactacgaggcccagcagggt
gctgggggccctgcccaccaagtgatcgtggaagccacagaaaaccctgtcttcgcccrc
tccactgtggtccatcctgaaccgaggcatcacccaccctcaaatcctcgacagcagtcc
cacctggactcaaggaccctgccacctggacagccaggacagcagcccagaagagaaacc
cccagagaatgcttgagggcgcctccatataaaccgcgcagagacgctttcgaaatttct
actgaagggcattctggccctagcaatagggaccgcacgggcccccggtga

DBGET integrated database retrieval system