KEGG   Bos indicus (zebu cattle): 109556404
Entry
109556404         CDS       T04792                                 

Gene name
CDC20
Definition
(RefSeq) cell division cycle protein 20 homolog
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04114  Oocyte meiosis
biu04120  Ubiquitin mediated proteolysis
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109556404 (CDC20)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109556404 (CDC20)
   04114 Oocyte meiosis
    109556404 (CDC20)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109556404 (CDC20)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109556404 (CDC20)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     109556404 (CDC20)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    109556404 (CDC20)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 ELYS-bb
Other DBs
NCBI-GeneID: 109556404
NCBI-ProteinID: XP_019813223
UniProt: A0A6P5B3Y8
LinkDB
Position
3
AA seq 499 aa
MAQFVFESDLHSLLQLDTPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTP
GKSSSKLQTTPSKPGGDRYIPHRNASQMEVASFLLSKENQPDNSETPTKKEHQKAWALNL
NGFDMEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDNSVYLWSASTGDILQLLQMEQPGDYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLCWNSYILSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKA
VAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGF
AQNQLVIWKYPTMAKVAELKGHTARVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcccagttcgtgttcgagagtgacttgcactcgctgctgcagctggatacacccatc
cccaatgcaccccctgcgcgctggcagcgcaaagcgaaggaagccgcgggaccggccccc
tcgcctatgcgggcagccaaccgatcccacagcgccggcaggaccccaggccgaactccc
ggcaaatccagctccaagcttcagaccactcccagcaaacctggcggtgaccgctatatc
ccccatcgcaatgcttcccagatggaggtggctagcttcctcctgagcaaggagaaccag
cctgacaacagtgagacgcccaccaagaaggaacatcagaaagcatgggctttgaatctg
aacggttttgacatggaggaagccaagatccttcggctcagtggaaaaccacaaaatgcc
ccagagggttaccagaacagactaaaagtactctatagccagaaggccacgccgggctcc
agcaggaagacctgycgttacattccttccctgccagaccgcatcctggatgcccctgaa
atccggaatgactactacctgaaccttgtggattggagctctgggaatgtgctggctgtg
gctttggacaacagtgtatacttgtggagtgctagcactggtgacattttgcagctgctg
caaatggagcagcctggggactatatatcttctgtggcctggatcaaagagggcaactac
ctggctgtgggcaccagcagtgccgaggtgcagctatgggatgtgcaacagcagaaacgg
cttcgaaacatgaccagtcattctgcccgagtgggctccctctgttggaatagctatatc
ctgtccagtggctcacgctccggccacatccaccaccatgacgttcgggtagcggaacac
catgtggccacgctgagtggccacagccaggaagtgtgtgggttgcgctgggccccggat
ggaaggcatctagccagtggcggcaacgacaatctggtcaacgtgtggcctagtgctcct
ggagagggcggctgggttcctctgcagaccttcacccagcatcaaggggctgtcaaggct
gtagcttggtgtccctggcagtccaacgtcctggcaactggcgggggcacaagtgaccga
cacattcgtatctggaacgtctgctctggggcctgtctgagtgccgtggatgcccattcc
caggtgtgctccatcctctggtctccccactacaaggagcttatctcaggccacggcttt
gcccagaaccagctggttatttggaagtacccaaccatggccaaggtggctgagctgaaa
ggtcacacagcccgggtgctcagtctgaccatgagcccagatggggctacagtggcatcc
gcagcagcagatgagaccctgcgactgtggcgctgctttgagctggaccctgcccggcgg
cgggagcgggagaaggccagcgcggccaaaagcagcctcatccaccaaggcatccgctga

DBGET integrated database retrieval system