KEGG   Bos indicus (zebu cattle): 109556419
Entry
109556419         CDS       T04792                                 

Gene name
SLC2A1
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1 isoform X1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04066  HIF-1 signaling pathway
biu04911  Insulin secretion
biu04919  Thyroid hormone signaling pathway
biu04920  Adipocytokine signaling pathway
biu04922  Glucagon signaling pathway
biu04931  Insulin resistance
biu04976  Bile secretion
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05211  Renal cell carcinoma
biu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    109556419 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109556419 (SLC2A1)
   04922 Glucagon signaling pathway
    109556419 (SLC2A1)
   04920 Adipocytokine signaling pathway
    109556419 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    109556419 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    109556419 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109556419 (SLC2A1)
   05230 Central carbon metabolism in cancer
    109556419 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    109556419 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109556419 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109556419 (SLC2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:biu02000]
    109556419 (SLC2A1)
Transporters [BR:biu02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   109556419 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    109556419 (SLC2A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF2127 TRI12 DUF523
Other DBs
NCBI-GeneID: 109556419
NCBI-ProteinID: XP_019813246
UniProt: A0A6P5B8P4
LinkDB
Position
3
AA seq 492 aa
MEPTSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVQRYGEPIPPAT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTELRGALGTLHQLGIVVGILIAQVFGLDSIM
GNQELWPLLLSVIFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRD
LQEMKEESRQMMREKKVTILELFRSAAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLER
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggagcccaccagcaagaagctgacaggccgcctcatgctggccgtgggaggggcagtg
ctcggctccctgcagtttggctacaacactggagtcatcaacgccccccagaaggtgatt
gaagagttctacaaccagacgtgggtccagcgctatggggagcccatcccgcccgccacg
ctgaccacgctctggtccctgtctgtggccatcttctcggtgggaggcatgattggttcc
ttctccgtgggcctttttgttaaccgtttcggccggcggaattcaatgctgatgatgaac
ctgctggccttcgtgtccgctgtgctcatgggcttctcaaaactgggaaagtcctttgag
atgctgatcctgggtcgcttcatcatcggtgtgtactgcggcctgaccactggytttgtg
cccatgtacgtgggggaggtatcccccacggagcttcgaggggccctgggcaccctgcac
cagctaggcatcgtcgtcggcatcctcatcgcccaggtgttcggcctggactccatcatg
ggcaaccaggaactgtggcccctgctgctgagcgtcatcttcatcccagccctgttgcag
tgcatcctgctgcccttctgccccgagagcccccgcttcctgctcattaaccgcaacgag
gagaaccgggccaagagcgtgctgaagaagctgcgtgggaccgcggacgtgacccgcgac
ctgcaggagatgaaggaggagagccggcagatgatgcgggagaagaaggtcaccatcctg
gagctgttccgctcagccgcctaccgccagcccatcctcattgccgtggtgctgcagctg
tcccagcagctgtccggcatcaacgctgttttctattactccacaagcatcttcgagaag
gcgggggtgcagcagcccgtgtatgccaccatcggctctggcatcgtcaacacagccttc
actgtcgtgtcgctatttgtggtggaacgagccggccggcggaccctgcacctcataggc
ctggccggcatggcaggctgtgcagtgctcatgaccatcgcgctggcgctgctggagcgg
ctgccctggatgtcctacctgagcattgtggccatctttggctttgtggccttttttgaa
gtgggyccaggccccatcccatggttcatcgtggctgaactcttcagccagggccctcgc
cctgctgccattgccgtcgctggcttctccaactggacttcgaatttcattgtgggcatg
tgcttccagtatgtggagcaactgtgcggaccctacgtcttcatcatcttcaccgtgctc
ctggttctgttcttcatcttcacctacttcaaagttcccgagacaaaaggccggaccttc
gatgagattgcttctggcttccggcagggaggagcaagtcaaagtgacaagacacctgag
gagctgttccaccccctgggagctgactcccaagtgtga

DBGET integrated database retrieval system