KEGG   Bos indicus (zebu cattle): 109556430Help
Entry
109556430         CDS       T04792                                 

Gene name
PPCS
Definition
(RefSeq) phosphopantothenate--cysteine ligase isoform X1
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00770  Pantothenate and CoA biosynthesis
biu01100  Metabolic pathways
Module
biu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    109556430 (PPCS)
Enzymes [BR:biu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     109556430 (PPCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP
Motif
Other DBs
NCBI-GeneID: 109556430
NCBI-ProteinID: XP_019813260
LinkDB All DBs
Position
3
AA seq 311 aa AA seqDB search
MAAVDLVAEFPQPAGAARWAEVMARFAARLGAXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXAFPFAHRFPPQTWLSVLRPSSQAPSGLLSLEA
EEKALPGFAAALRSYQEAEAAGTFLAIEFTTLADYLHLLQAAAQALNPLGSSAMFYLAAA
VSDFYVPASEMPEHKIQSSGGPLQITMKMVPKMLSPLVKDWAPKAFIISFKLETDPSIII
DRARNALEVYRHQVVVANILDSRRSSVVIITKDSETKLLLSEEEVEKGIEIEEKIVDDLQ
SRHTAFIHDKN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtggacctggttgctgagtttccccagccggccggtgctgcgcgctgggca
gaggttatggctcgcttcgccgcccggttgggcgcnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnctgccttcccctttgcccaccgcttcccgccccagacc
tggctgtctgttctgcggccctccagccaagcgccttcgggcttgctgagcctggaggcg
gaggaaaaagcactcccgggcttcgccgcagctctgcggagctaccaggaagctgaggct
gccggcacctttctggccatagagttcaccactttggcagactatttgcatttgctgcag
gctgcagcccaggctctcaacccactaggttcttctgcgatgttttacctggctgcggcc
gtgtcagatttctatgttcctgcctctgaaatgcctgaacacaagatccagtcatctggg
ggcccactgcagataacaatgaagatggtgccaaaaatgctttctcctttggttaaagac
tgggctcccaaagcatttataatttcctttaagttggagactgatccctccatcataatt
gaccgtgcacggaatgctttagaagtttatcgacatcaagtggtggtggctaatatcctt
gattcacgacgatcttctgtggttattataaccaaagactcagaaaccaagttactgtta
tcagaggaagaagtagaaaaaggcatagagatagaagagaagatagtggatgatcttcag
tctcgacatactgcttttatacatgacaaaaactga

DBGET integrated database retrieval system