KEGG   Bos indicus (zebu cattle): 109556495
Entry
109556495         CDS       T04792                                 

Gene name
CSF3R
Definition
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109556495 (CSF3R)
   04151 PI3K-Akt signaling pathway
    109556495 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109556495 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109556495 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109556495 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109556495 (CSF3R)
   04090 CD molecules [BR:biu04090]
    109556495 (CSF3R)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  Prolactin receptor family
   109556495 (CSF3R)
CD molecules [BR:biu04090]
 Proteins
  109556495 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind Pur_ac_phosph_N IL6Ra-bind Tissue_fac ObR_Ig
Other DBs
NCBI-GeneID: 109556495
NCBI-ProteinID: XP_019813379
UniProt: A0A6P5BPN9
LinkDB
Position
3
AA seq 841 aa
MVGLGAWSLVGAALIILLLPRSLEQCGHILLSAPIVRLGDQVTASCIINRNCSHLGTDWR
VVWKLEPELHPRERRQHLPNGTLQSTITLPHLNHSRVLLSCCLHWGNSLQILDQAELQAG
YPPTAPYNLSCIMNLTTNSLICQWEPGPNTHLSTSFTLKSFKSQDKCQTQKDSIPDCVPE
VGQSHCSIPRKHLQLYQNMSIWVQARNALGTSASPKLCLAPMDVVKLEPPTLWALEPSPA
VAPPQPGCLRLRWETWRPSLYIEQKCELRHQPRLREAGWDLVSALPARTSQYELCGLLPS
TAYTLQMRCTRWRLPGHWSEWSPSLELTTAQRAPIVRLDTWWRQRQLDPETVTVQLFWKP
IALEEDSGQIQGYLVSWRPSDQAGAEPTLCDTTELNCTFQLPSEAREVVLKAYNTAGTSH
PTPVVFLESRGPPLGRLHTTARDPHSLWVGWEPPSPQPQGYVIEWGLSPPSPNGSPMTWR
MEHNGSIAGTLLQENIRPFQLYEITVTPLYQDTKGPSQHIYAYSQEMAPSHGPELHLRHI
GKTWAQLEWVPEAPELGKSPLTHYTIFWTNTQDQSFSTVLNASTHSFVLRGLEPSSLYHV
QLMAASQVWAANSTSLTLMTLTLEESELHILLGLFGLLVLLICLCGAAQFCCRPSRKYSL
WPSVPDPARSSLGSWVPTITAEDILQLPSLRDPGMPPITKITVLEEEEKKPGPWESNASS
GPGSLSTLVQAYVLQGDPRVPSAQPQPQPGNSDQVLYVQVLGSPTGPGPGHYLRCDSTQP
LLEGLSPSPKSYENLWFQXSSPGTPEPLVPHPEDDSIFEPLLDFPLLQGLRVSGAEGLGG
F
NT seq 2526 nt   +upstreamnt  +downstreamnt
atggtggggctgggagcctggagcctggtgggagctgctctgatcatcctcctgctcccc
agaagcctggagcagtgtgggcatatcctcctctcagcccccatcgtccgcctgggagat
caagtcacggcctcctgcatcatcaaccggaactgcagccacctgggcaccgactggcga
gttgtatggaaactggaaccggagcttcatcccagggagaggcggcagcacctgccgaac
gggaccctgcagtccaccatcaccttgccccacctcaaccactctcgggtccttctctcc
tgctgcctgcactggggcaacagcctgcagatcctggaccaggctgagctacaggcgggc
taccctcccactgcaccctacaacctatcctgcatcatgaacctcacaaccaacagcctc
atctgtcagtgggagccaggccccaacacccacctgtccaccagcttcaccctgaagagc
ttcaagagccaggacaaatgccagacgcagaaggattccatccctgactgcgtgccggaa
gtcgggcagagccactgctccatcccccgcaaacacctgcagctgtaccagaacatgagc
atctgggtgcaggccaggaacgcgctggggaccagcgcttccccaaagctctgcctggct
cccatggacgttgtgaaactggagccccccacactgtgggccctggagcccagccctgcg
gtggccccgcctcagccaggctgcctgaggctgcgctgggagacctggaggccaagtctg
tacatagaacagaagtgtgagctgcgccaccagcctcggcttagagaagccggctgggac
ctggtgagcgccctgcccgccaggacctcccagtatgaactctgcgggctcctcccatcc
acagcctacaccctgcaaatgcgctgcacccgctggcgcctgcccggccactggagcgaa
tggagccccagcctggagctgaccaccgcacaacgggcccccatcgtcagactggacacg
tggtggcggcagaggcagctggaccccgagacggtgaccgtgcagctgttctggaagcca
atagccctggaagaagacagcggacagatccaaggttacctggtttcctggagaccctca
gaccaggctggggcagagccaaccctctgtgacaccacggagctgaactgtaccttccaa
ctgccttcagaagcccgggaggtggtccttaaggcctataacacagctgggacctcgcat
cccacccccgtggttttcttggaaagcagaggcccacccctgggcagactccacaccacc
gctcgagaccctcatagcctctgggtgggctgggagccccccagtcctcaacctcagggc
tatgtgattgagtggggcctcagtccccccagccccaacggcagtcctatgacctggagg
atggagcataayggaagcattgcagggaccttgctgcaggagaacatcaggccctttcag
ctctacgagatcactgtgacccccctgtaccaggacaccaagggaccctcccagcatatc
tatgcctactcccaagagatggccccctcccatggcccagagttgcatctcaggcacatt
ggcaagacgtgggcccagctggagtgggtgcctgaggcccctgagctggggaagagcccc
cttacccactacaccatcttctggaccaacactcaggaccagtccttctccactgtcctg
aatgcctccacccacagctttgtcctccgtggcctggagccttctagcttgtaccatgtc
caactcatggccgccagccaggtgtgggccgccaacagcacaagcctcaccctgatgacc
ttgactctagaggagtctgagctgcacatcctcctgggcctgttcggcctcctggtcttg
ctcatctgcctctgtggggctgcccagttctgctgcagacccagcaggaagtattccctc
tggccgagtgtcccggacccagcccgcagcagcctgggttcctgggtgccaaccatcacr
gcggaggatatcttacagctgcccagccttcgggaccccggcatgccacccatcaccaag
atcacggtgctggaggaggaagagaagaagccagggccctgggagtccaatgccagctca
gggcccggtagcctctccacccttgtccaggcctatgtgctccagggggacccaagagtg
ccctccgctcagcctcagccccagcctggcaacagcgaccaggtgctttacgtgcaggtg
ctgggcagccccacgggcccagggcctgggcactacctccgctgcgactcaactcagccc
ctcttggagggcctctcccccagtcccaagtcctacgagaacctctggttccagrccagc
tctccggggaccccagagcccctagtcccacatccggaggacgacagtatctttgagcct
ctgcttgacttccctctactacaaggactccgggtcagtggggcggagggtcttgggggc
ttctag

DBGET integrated database retrieval system