KEGG   Bos indicus (zebu cattle): 109556511
Entry
109556511         CDS       T04792                                 

Gene name
HES1
Definition
(RefSeq) transcription factor HES-1
  KO
K06054  hairy and enhancer of split 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03460  Fanconi anemia pathway
biu04330  Notch signaling pathway
biu04950  Maturity onset diabetes of the young
biu05165  Human papillomavirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    109556511 (HES1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    109556511 (HES1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109556511 (HES1)
  09162 Cancer: specific types
   05224 Breast cancer
    109556511 (HES1)
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    109556511 (HES1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109556511 (HES1)
   05165 Human papillomavirus infection
    109556511 (HES1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109556511 (HES1)
   03400 DNA repair and recombination proteins [BR:biu03400]
    109556511 (HES1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    109556511 (HES1)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     109556511 (HES1)
SSDB
Motif
Pfam: Hairy_orange HLH
Other DBs
NCBI-GeneID: 109556511
NCBI-ProteinID: XP_019813416
UniProt: A0A6P5B964
LinkDB
Position
1
AA seq 280 aa
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGXXGPLHAP
FAPPPPLVPIPGGAAPPPGGAPCKLGSPAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH
SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
NT seq 843 nt   +upstreamnt  +downstreamnt
atgccagctgatataatggagaaaaactcctcgtccccggtggctgctactccagccagt
gtcaacacgacaccggataaaccaaagacagcatctgagcacagaaagtcatcaaagcct
atcatggagaaaagacgaagagcaagaataaatgaaagtctgagccagctaaaaacactg
attttggatgctcttaaaaaagatagttcgcggcattccaagctggagaaggcggacatt
ctggaaatgacagtgaaacacctccggaacctgcagcgggcacagatgacggccgcgcta
agcacagacccgagcgtgctggggaagtaccgcgccggcttcagcgagtgcatgaacgag
gtgacccgcttcctgtccacgtgtgagggcgttaacaccgaggtgcgcacccgactcctc
ggccacctggccaactgtatgacccagatcaacgccatgacctatccagggcagccgcac
cccgccttgcaggcgccaccgccgcccccgccaggacnnngcggcccgctgcacgcgccg
ttcgcgccgccgccgccgctcgtgccgatccccgggggtgcggcgccccctcccggcggc
gcgccctgcaagctgggcagccctgctggagaggcggctaaggtgtttggcggcttccag
gtggtgccggctccggacggccagtttgccttcctcatccccaatggggccttcgctcac
agcggcccagtcatcccagtctacaccagcaacagcgggacctcggtgggccccaacgca
gtgtcaccttccagcggcccctctctcacggcagactccatgtggagaccgtggcggaac
tga

DBGET integrated database retrieval system