KEGG   Bos indicus (zebu cattle): 109556631
Entry
109556631         CDS       T04792                                 

Definition
(RefSeq) T-cell surface glycoprotein CD1b-2-like
  KO
K06448  T-cell surface glycoprotein CD1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04530  Tight junction
biu04640  Hematopoietic cell lineage
biu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109556631
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109556631
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109556631
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109556631
CD molecules [BR:biu04090]
 Proteins
  109556631
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3
Other DBs
NCBI-GeneID: 109556631
NCBI-ProteinID: XP_019813665
UniProt: A0A6P5BPX4
LinkDB
Position
3
AA seq 233 aa
LVSVFFYTDPFVIQXTAGCELHSGKAIGSSLRGALGGLDFVSIQNHSCVSAPDSGXRGQK
FCARMTQNSVISYFERLLSETCPRYLLGVLDAGKAELQRQVKPEAWLSSGPTPGPGRLLL
VCHVSGFYPKPVRVMWMRGEQEQPGTQQGDJMPNADWTWYLRVTLNVAAGEXAGLNCRVK
HSSLGDQDIILYWGHPTSIGLILVAIIIPSLILLICLAFGVLRFMGSHRVGHD
NT seq 702 nt   +upstreamnt  +downstreamnt
cttgtctcagttttcttttacacagacccctttgtgatccagstcacagcaggctgtgag
ctgcattctgggaaggccataggaagctctttgagaggagctttaggaggactggatttt
gtgagtatccagaatcattcctgtgtgtctgcaccagacagcggnntcagggggcagaag
ttttgtgcacgcatgactcagaattcagtcatctcttatttcgagagactcctctcagaa
acctgtcctcgatatcttctgggtgtcctcgatgcagggaaggcagaactgcagagacaa
gtgaagcctgaagcctggctgtccagtggccccactcctgggcctggccgcctactgctg
gtgtgccacgtctcaggattctacccaaaacctgtgcgggtgatgtggatgaggggcgag
caggagcagcctggcactcagcaaggagacmtcatgcccaatgcagactggacttggtat
ctccgagtaaccctaaatgtggcagctggggaggyagctggcctgaattgccgagtgaag
cacagcagtctaggagaccaggacatcatcctgtactggggacaccccacatccattggc
ttgatacttgtggcaataataataccctccttgatccttttgatatgccttgcatttggt
gtgctgcgattcatggggtcgcacagagttggacatgactga

KEGG   Bos indicus (zebu cattle): 109556709
Entry
109556709         CDS       T04792                                 

Definition
(RefSeq) T-cell surface glycoprotein CD1b-2-like
  KO
K06448  T-cell surface glycoprotein CD1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04530  Tight junction
biu04640  Hematopoietic cell lineage
biu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109556709
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109556709
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109556709
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109556709
CD molecules [BR:biu04090]
 Proteins
  109556709
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3
Other DBs
NCBI-GeneID: 109556709
NCBI-ProteinID: XP_019813704
UniProt: A0A6P5BQ16
LinkDB
Position
3
AA seq 358 aa
MEPEALGAGDHFKFCIVVQTLGSFSYYPBSTSPPHSSYLSTXTVFQGPTSFHLIQISTFV
NXTWAQNQGSGWLDDLQIHGWESDSGTAIFLKPWSKGNFSDDEVTELVDLFRAYFIGFTR
EVQDXVNEFQLEYPFVIQVXAGCELHSGEAIESSLRGALGGLDFVSIQNHSCVPAPDGSS
RGQKFCALTTQYQGISDIIERLLSETCPRYLLGVLDAGKAELQRQVKPEAWLSSGPTPGP
GRLLLVCHVSGFYPKPVRVMWMRGEQEQPGTQQGDLMPNADWTWYLLVTLNVAAGEAAGL
NCRVKHSSLGDQDIILYWGHPTSIGLILVAIIIPSLILLICLAFGVLRFMGSHRIGHD
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggagccagaagctttgggggcaggggaccatttcaagttctgtattgttgttcagact
ctgggttctttttcatactatcctrattccacatctcctcctcattcttcttatctttcc
acyrctacagtgttccaggggccaacctccttccatctcatccagatttcaacctttgtc
aatarcacatgggctcaaaatcaaggctcaggctggttggatgacttgcagattcatggc
tgggagagtgactcgggmactgccattttcctgaagccctggtccaagggcaactttagt
gatgatgaggtgactgagctggtggacctcttccgagcctacttcattggattcactcgg
gaagtgcaggatcsagtcaatgagttccagttggaatayccctttgtgatccaggtcaya
gcaggctgtgagctgcattctggggaggccatagaaagytctttgagaggagctttagga
ggactggattttgtgagtatccagaatcattcttgtgtgcctgcaccagacggcagcagc
agggggcagaagttttgtgcactcacgactcagtatcaaggcatctctgatatcatcgag
agactyctctcagaaacctgtcctcgatatcttctgggtgtcctcgatgcagggaaggca
gaactgcagaggcaagtgaagcctgaagcctggctgtccagtggccccactcctgggcct
ggccgcctactgctggtgtgccacgtctcaggattctacccaaaacctgtgcgggtgatg
tggatgaggggcgagcaggagcagcctggcactcagcaaggagacctcatgcccaatgca
gactggacttggtatctcttagtaaccctaaatgtggcagctggggaggcagctggcctg
aattgccgagtgaagcacagcagtctaggagaccaggacatcatcctgtactggggacac
cccacatccattggcttgatacttgtggcaataataataccctccttgatccttttgata
tgccttgcatttggtgtgctgcgattcatggggtcgcacagaattggacatgactga

KEGG   Bos indicus (zebu cattle): 109556712
Entry
109556712         CDS       T04792                                 

Definition
(RefSeq) T-cell surface glycoprotein CD1a-like
  KO
K06448  T-cell surface glycoprotein CD1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04530  Tight junction
biu04640  Hematopoietic cell lineage
biu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109556712
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109556712
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109556712
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109556712
CD molecules [BR:biu04090]
 Proteins
  109556712
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3
Other DBs
NCBI-GeneID: 109556712
NCBI-ProteinID: XP_019813705
UniProt: A0A6P5BPZ1
LinkDB
Position
3
AA seq 342 aa
MLFLQLPLLLALLVGGDNEQNKNSVPEGFQEPISFEVICVLSFHNSSWVQSLGSGWLGEL
QTHGWKSNSGTFIYLWPWSKGNFSNEELMELQNYLHTNFVRFVQAFYSHARKWQFEYPFE
VQIAKGCELHAGEVPVGFMRIAYQGSDFLSFQNKSWVSSPEGGKRAQVLRRLXNLFRGXQ
EIIHKLLSDTCPRFLLGLLDAGKAYLQRQVRPEAWLSLGPSPGPGQLTLVCHISGFYPKP
IWVMWMRGEQEQQGTQRNDVLPNSDGTSYLRVSLDVEAIEAPGLSCRVRHSSLGGQDIIL
YWGEEELEPRWDGNRWSSGRVKEPDEKLGILGTPDPKGIKIK
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgctatttctgcaacttccattgctcctggctctcctcgtgggtggagacaatgaacag
aataagaattctgttccagaaggctttcaggagcccatttccttcgaagtcatctgtgtc
ctatcctttcacaacagttcttgggtgcaaagtctgggctcaggctggttgggtgagttg
cagactcatggctggaagagcaactctggcacttttatttacctgtggccttggtccaag
ggcaacttcagcaatgaagagttgatggaactgcaaaattatttgcacacgaacttcgtt
agatttgttcaggcattttacagccatgccagaaaatggcaatttgaatatccctttgag
gtacagatagcaaaaggctgtgagctgcatgctggggaagtcccagtaggctttatgcgg
attgcttatcaaggatcagacttcttgagctttcagaacaagtcatgggtgtcctctcca
gagggtggaaagagggctcaagtcctcagaagactaytcaatttgttccgaggagsccag
gaaataatacacaagctgctcagtgatacctgcccacgtttcctcttgggtcttcttgat
gccgggaaggcatatctccagagacaagtacgaccagaggcctggctctcccttggcccc
agtcctggccctggacaactgacgctggtttgtcacatctctggcttctacccaaagcct
atttgggtgatgtggatgcggggtgagcaggagcaacagggcactcagagaaatgatgtc
ttacctaactctgatgggacatcgtatcttcgggtttccttggatgtggaagccattgag
gcacctggcctgagttgccgggtgaggcacagcagtctaggaggccaggacatcatcctc
tactggggtgaggaagaactggagccccgctgggatgggaataggtggtcctcaggcaga
gtaaaagagccagatgaaaaattggggattctagggactccagacccaaaaggaataaaa
ataaaataa

KEGG   Bos indicus (zebu cattle): 109556982
Entry
109556982         CDS       T04792                                 

Definition
(RefSeq) T-cell surface glycoprotein CD1b-3
  KO
K06448  T-cell surface glycoprotein CD1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04530  Tight junction
biu04640  Hematopoietic cell lineage
biu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109556982
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109556982
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109556982
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109556982
CD molecules [BR:biu04090]
 Proteins
  109556982
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3
Other DBs
NCBI-GeneID: 109556982
NCBI-ProteinID: XP_019813901
UniProt: A0A6P5BAJ9
LinkDB
Position
3
AA seq 333 aa
MLLLPLLLLAVIVPGGDNEDAFQGPTSFHLIQISTFANSTWTQNQGSGWLDDLQIHGWDS
DSGTAIFLKPWSKGNFSDEEVAEMEELFRVYFIGFTLEVQDIVSEFQFEYPFVIQGIAGC
ELHSGKVIQSFLRAGFGGLDFMSIKNRSCVPEPEGGSDAQWFCVFITQYQGILRIIDTLL
SETCPRYLLGVLDAGKAELQRQVKPEAWLSSGPTPXPGXLLLVCHVSGFYPKPVRVMWMR
GEQEQPGTQQGNIMPNADWTWYLRVTLDVVAGEAAGLSCRVKHSSLGDQDIILYWGHPKY
IGLISVAIIVPSLILLICLALWLWRRWSYQTIL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgctgcttctgccacttctattgctagcagttattgtsccaggtggtgacaatgaggat
gcattccaggggccaacctccttccatctcatccagatttcaacctttgccaacagcacc
tggactcaaaatcaaggctcaggctggttggatgatttgcagattcatggctgggacagt
gactcaggcactgccatcttcctgaagccctggtcaaagggcaacttcagtgatgaggag
gtggctgagatggaggaactattccgagtctacttcattgggttcactctggaagtgcag
gatattgtaagtgaattccagtttgaatacccgtttgtgattcagggcatagcaggttgt
gagctgcattctgggaaggtcatacaaagcttcttgagagcaggttttggaggactggat
ttcatgagcatcaagaatcgttcatgtgtgcctgagccagagggaggcagtgatgcacag
tggttttgtgtattcattactcagtaccaaggcatcttgcgtatcatagacacactcctc
tcagaaacctgcccccgatatctcctgggtgtcctcgatgcagggaaggcggaactgcag
aggcaagtgaagcctgaagcctggctgtccagtggccccactcctrggcctggccrccta
ctgctggtctgccatgtctcaggattctacccaaaacctgtgcgggtgatgtggatgagg
ggtgagcaggagcagcctggcactcagcaaggaaacatcatgcccaatgctgactggact
tggtatctccgagtaaccctggatgtggtggctggggaggcggctgggctgagttgtcga
gtgaagcacagcagtctaggagaccaggacatcatactgtactggggacaccccaagtac
attggcttgatatctgtggcaataatagtgccctccttgatccttttgatatgtcttgca
ttatggctttggaggcgttggtcatatcagactatcttgtga

KEGG   Bos indicus (zebu cattle): 109578976
Entry
109578976         CDS       T04792                                 

Definition
(RefSeq) T-cell surface glycoprotein CD1a-like isoform X1
  KO
K06448  T-cell surface glycoprotein CD1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04530  Tight junction
biu04640  Hematopoietic cell lineage
biu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109578976
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109578976
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109578976
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109578976
CD molecules [BR:biu04090]
 Proteins
  109578976
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I BTK Ig_3
Other DBs
NCBI-GeneID: 109578976
NCBI-ProteinID: XP_019843988
UniProt: A0A6P5E047
LinkDB
Position
3
AA seq 347 aa
MLFXQIALLLSLLPCGDSENDFQEPITFKIIRISSFYSQFFAQNLGSAWLDELQTHAWDN
NSDRVIYLRPWSKGNFSNEELMDVENVLHTFFIRLGQVLHNHASQWQLQYPFELQIAGGC
EMHIRDASVGFVRIGYQGSDFLSFQKDVWVPSPEGGISAQFVCTLFNLYRGTQEIIHKLL
SDTCPRFLLSLLDAGKAYLQRQVRPEAWLSPGPSPGPGQLMLVCHVSGFYPKPIWVXWMR
GEQEQQGTQRSDVLPNADGTWYLRVSLDVEASEASGLSCRVRHSSLGGQDIILYWDHHSS
TAWIILAMIVPLVLLAGLAFWLRKSWTCCKPSNTLLPLERGPSSPGT
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgctgtttckgcaaattgcattgctcctgtctcttctcccatgtggtgacagtgagaat
gacttccaggagccaatcactttcaaaatcattcggatctcatcattttatagccaattc
tttgcacaaaatctgggctcagcttggttggatgagttgcagactcatgcctgggacaac
aactctgacagagtcatttacctgcgtccttggtccaaaggcaacttcagtaatgaggag
ttgatggacgtggaaaatgtacttcatacattcttcattagacttggtcaggtacttcac
aaccatgccagccaatggcagcttcaatatccctttgaactgcagatagcaggtggctgt
gagatgcacatcagagatgcctcagtaggctttgtgcgaatcggttatcaaggatcagac
ttcctaagcttccagaaagatgtatgggtaccctctccagagggtggaattagtgctcag
tttgtctgcacactattcaatttgtaccgaggcacccaggaaataatacacaagctgctc
agtgacacctgcccacgtttcctcttgagtcttcttgatgcaggaaaggcatatctccag
agacaagtacgaccagaggcctggctgtccccgggccccagtcctggccctggccaactg
atgctggtttgtcacgtctctggcttctacccaaagcccatttgggtgatrtggatgcgg
ggtgarcaggagcaacagggcactcagagaagtgacgtcttrcctaacgctgatgggaca
tggtatcttcgggtttccttggatgtggaagccagtgaggcatctggcctgagttgccgg
gtgaggcacagcagtctaggaggccaggacatcatcctctactgggatcatcacagctcc
actgcctggatcatcttggcaatgattgtgcccctggtcctcctggcaggtcttgcattt
tggcttaggaagagctggacttgctgtaaaccttcaaacacacttctccctttggaaaga
ggtcccagcagcccaggaacctag

KEGG   Bos indicus (zebu cattle): 109578994
Entry
109578994         CDS       T04792                                 

Definition
(RefSeq) T-cell surface glycoprotein CD1e, membrane-associated-like
  KO
K06448  T-cell surface glycoprotein CD1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04530  Tight junction
biu04640  Hematopoietic cell lineage
biu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109578994
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109578994
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109578994
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109578994
CD molecules [BR:biu04090]
 Proteins
  109578994
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I
Other DBs
NCBI-GeneID: 109578994
NCBI-ProteinID: XP_019844002
UniProt: A0A6P5E3X1
LinkDB
Position
3
AA seq 392 aa
MLXLLPLLPLLFKGLLCHGASTVGLQVPGPHHLAAEESXSFRLIQISSFANHSWTKTQGS
GWLGDLQTHGWDSVLASIRFLRPWSQGNFSKEELKNIQAXLQLYXHSFPREVQAYASQFQ
FEYPFELQVSFGCLIHXGKALETFLNGAYQGLDFLSFQENSWKPSPEAGSRAENVCKVLN
HYRVIKEIVQRLLSDTCPRFLAGVLEAGKAELEKQVKPEAWVSKGPSPGPGRLLLVCHVS
GFHPKPIWVMWMRGKQKHPGTRRGDVLPNADGTWYLRVTLDVAAGEAAGLSCQVKHSSLG
GQDIIIHWGGYSVFWILICLIVIVTLVMLVIVDSLFKKQSSNQDVFSISHPAFPIGAKTQ
DPRNSGHQLCLAQESWIKNKLLKKWKARLNQL
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgctgcytctgctgcctctgctgcctctgctmttcaagggacttctctgccatggggca
agcacagtgggtcttcaggttccaggaccccatcatctggctgcagaagaatccycctcc
ttccgcttgatccagatctcctcctttgccaaycacagctggacgaagacccagggctca
ggctggctgggcgacctgcagactcatggctgggatagtgtcttggccagcatccgcttt
ctgaggccctggtcccagggtaacttcagcaaggaggaactgaagaacatccaggcaytc
ttacagctgtacytccacagtttcccacgggaagtgcaggcctatgccagtcagtttcag
tttgaatacccctttgagctccaggtatcatttggatgtttaattcatwctgggaaggct
ttggaaaccttcttaaatggagcatatcaaggattagatttcctgagtttccaagaaaat
tcctggaagccatctccagaagcaggaagtcgagctgagaatgtctgtaaggtgctcaac
cactaccgagttattaaagaaattgtgcagaggcttctcagtgacacctgtcctcggttt
ctggcaggagtccttgaagcagggaaggcagaactggaaaaacaagtgaagccagaggct
tgggtgtccaaaggccccagtcctgggcctggccgtctgttgttggtgtgccatgtctct
ggctttcatccaaagcccatatgggtgatgtggatgaggggtaagcagaagcacccaggg
actcgacgaggtgatgtcttgcccaatgctgatgggacctggtatctccgagtaaccctg
gatgtggcagctggggaggcggctggcctgagttgccaagtgaagcacagcagcctagga
ggccaggacatcatcatccactggggtggatactccgtattctggatattgatctgctta
attgtaatagttaccttggtcatgttggttatagttgattcattgtttaaaaagcagagc
tcaaatcaggatgtcttctctatctcccaccctgcctttcccataggagccaaaacccaa
gaccccaggaattcaggacatcagctctgcttggcacaggaatcatggatcaaaaacaaa
ctcttaaagaaatggaaagctagactaaatcaactctag

KEGG   Bos indicus (zebu cattle): 109579006
Entry
109579006         CDS       T04792                                 

Definition
(RefSeq) antigen-presenting glycoprotein CD1d-like
  KO
K06448  T-cell surface glycoprotein CD1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04530  Tight junction
biu04640  Hematopoietic cell lineage
biu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109579006
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109579006
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109579006
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109579006
CD molecules [BR:biu04090]
 Proteins
  109579006
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3 FixQ
Other DBs
NCBI-GeneID: 109579006
NCBI-ProteinID: XP_019844030
UniProt: A0A6P5E3I9
LinkDB
Position
3
AA seq 415 aa
MSGTGLRAERGSRAGKGDDARGGRAETDAPRKAGSLIHQPENLLLPAFSCLAPGDRARFR
ASRHHPFFPNLTVCFFLFSFLLPSVLSLPCPRLLRSVFSPAPHMSFPFQFLQISSFSNRS
WTRTDGLAWLGELQPYTWRNESNTIGFLKPWSRGTFSDQQWEQLQHTLLVYRSSFTRDIW
EFVEKLHVEYPLEIQIATGCELLPRNISESFFRAAFQGKDVLSFQGMSWVSAPDAPPFIQ
EVCKRLNQDQGTKETVHWLLHDIWPELVRGLLQTGKSELEKQVKPEAWLSSGPSPGPGRL
LLVCHVSGFYPKPVRVMWMKGEQEEPGTRQGDVMPNVDSTWYLRVTLDVAAGEAAGLSCQ
VKHSSLGDQDIILYWDGNHVSRGLIVALVLLVFVLLFVGGLVFWFRKHRRYQDIP
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgagtggaactgggctgagggcagagagagggagccgagcagggaaaggggacgacgct
cgcggcgggcgggcggagactgatgcacctcgaaaagccgggagcttgatccaccagccc
gagaacctgctactccctgccttcagctgcttggcccctggagaccgagctcgattcaga
gcgagcagacatcaccctttcttcccaaacctaactgtttgtttctttcttttttccttc
cttctcccttctgtactctccctcccgtgcccccggctcctccgatctgtattctctcca
gccccgcacatgtctttccccttccagttcctccagatctcctcgttctccaaccgcagc
tggacgcgcacagacggcctcgcgtggctgggggagctgcagccctatacttggcgcaat
gaatcgaacaccatcggcttcctgaagccttggtctcggggcacattcagcgaccagcag
tgggagcagctgcagcatacacttctggtttatcgcagcagcttcaccagggacatctgg
gaattcgtcgaaaagctgcacgtcgaatatccacttgagatccagatagctacaggatgt
gagctgctcccgaggaacatctcagaaagcttcttccgcgcagcatttcaaggaaaggat
gtcctgagtttccaaggaatgtcttgggtgtcagccccagatgccccgccttttatccag
gaggtctgcaagaggctcaatcaggaccaagggaccaaggaaacggtgcactggctcctc
catgacatctggcccgagttggtcagaggcctcttgcagaccgggaagtctgagttggag
aagcaagtgaagccggaggcttggctgtccagtggccccagtcctgggcctggccgtctg
ctgctggtgtgccacgtctcaggattctatccaaaacctgtgcgggtgatgtggatgaag
ggcgagcaggaggagcctggcactcggcaaggagacgtcatgcccaatgtcgactcgact
tggtatctgcgagtaaccctggatgtggcggctggggaggcggctggcctgagttgccaa
gtgaagcacagcagtctaggagaccaggacatcatcctgtactgggatgggaaccatgtc
tccaggggcttgattgttgccctggtactactggtgttcgtccttctgtttgttggaggc
ttagtcttctggtttaggaagcaccgccgctatcaagatatcccatga

KEGG   Bos indicus (zebu cattle): 109579016
Entry
109579016         CDS       T04792                                 

Definition
(RefSeq) antigen-presenting glycoprotein CD1d-like
  KO
K06448  T-cell surface glycoprotein CD1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04530  Tight junction
biu04640  Hematopoietic cell lineage
biu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109579016
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109579016
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109579016
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109579016
CD molecules [BR:biu04090]
 Proteins
  109579016
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3 FixQ
Other DBs
NCBI-GeneID: 109579016
NCBI-ProteinID: XP_019844054
UniProt: A0A6P5E159
LinkDB
Position
3
AA seq 415 aa
MSGTGLRAERGSRAGKGDDARGGRAETDAPRKAGSLIHQPENLLLPAFSCLAPGDRARFR
ASRHHPFFPNLTVCFFLFSFLLPSVLSLPCPRLLRSVFSPAPHMSFPFQFLQISSFSNRS
WTRTDGLAWLGELQPYTWRNESNTIGFLKPWSRGTFSDQQWEQLQHTFLVYRSSFTRDIW
EFVEKLHVEYPLEIQIATGCELLPRNISESFFRAAFQGKDVLSFQGMSWVSAPDAPPFIQ
EVCKRLNQDQGTKETVHWLLHDIWPELVRGLLQTGKSELEKQVKPEAWLSSGPSPGPGRL
LLVCHVSGFYPKPVRVMWMKGEQEEPGTRQGDVMPNVDSTWYLRVTLDVAAGEAAGLSCQ
VKHSSLGDQDIILYWDGNHVSRGLIVALVLLVFVLLFVGGLVFWFRKHRRYQDIP
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgagtggaactgggctgagggcagagagagggagccgagcagggaaaggggacgacgct
cgcggcgggcgggcggagactgatgcacctcgaaaagccgggagcttgatccaccagccc
gagaacctgctactccctgccttcagctgcttggcccctggagaccgagctcgattcaga
gcgagcagacatcaccctttcttcccaaacctaactgtttgtttctttcttttttccttc
cttctcccttctgtactctccctcccgtgcccccggctcctccgatctgtattctctcca
gccccgcacatgtctttccccttccagttcctccagatctcctcgttctccaaccgcagc
tggacgcgcacagacggcctcgcgtggctgggggagctgcagccctatacttggcgcaat
gaatcgaacaccatcggcttcctgaagccttggtctcggggcacattcagcgaccagcag
tgggagcagctgcagcatacatttctggtttatcgcagcagcttcaccagggacatctgg
gaattcgtggaaaagctgcacgtcgaatatccacttgagatccagatagctacaggatgt
gagctgctcccgaggaacatctcagaaagcttcttccgcgcagcatttcaaggaaaggat
gtcctgagtttccaaggaatgtcttgggtgtcagccccagatgccccgccttttatccag
gaggtctgcaagaggctcaatcaggaccaagggaccaaggaaacggtgcactggctcctc
catgacatctggcccgagttggtcagaggcctcttgcagaccgggaagtctgagttggag
aagcaagtgaagccggaggcttggctgtccagtggccccagtcctgggcctggccgtctg
ctgctggtgtgccacgtctcaggattctatccaaaacctgtgcgggtgatgtggatgaag
ggcgagcaggaggagcctggcactcggcaaggagacgtcatgcccaatgtcgactcgact
tggtatctgcgagtaaccctggatgtggcggctggggaggcggctggcctgagttgccaa
gtgaagcacagcagtctaggagaccaggacatcatcctgtactgggatgggaaccatgtc
tccaggggcttgattgttgccctggtactactggtgttcgtccttctgtttgttggaggc
ttagtcttctggtttaggaagcaccgccgctatcaagatatcccatga

KEGG   Bos indicus (zebu cattle): 109579024
Entry
109579024         CDS       T04792                                 

Definition
(RefSeq) antigen-presenting glycoprotein CD1d-like
  KO
K06448  T-cell surface glycoprotein CD1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04530  Tight junction
biu04640  Hematopoietic cell lineage
biu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109579024
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109579024
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109579024
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109579024
CD molecules [BR:biu04090]
 Proteins
  109579024
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I ig FixQ
Other DBs
NCBI-GeneID: 109579024
NCBI-ProteinID: XP_019844063
UniProt: A0A6P5E0E6
LinkDB
Position
3
AA seq 418 aa
MSGTGDSRKRSARGSRAGKGEDAXGGRAQTDAPRKAGSLIXQXENLLLPASSCLAPGDRA
RFRASRHHPFFPNLTXSFFLFFFLFPSVLSLPFPRLLXSVFSPXPQTPFSFHGLQISSLA
NSSWTRTDCLGWLGELQPYTWRNESDTIRFLKPWSRGTFSDQQWEQLQHTFQVYRSSFTK
VLWEFVKRLHAEYPLEIQVSGGCELLPRNISESFLRAAFQGXDVLSFQGMSWVSAPDAPP
LIEEVIKVLNQBQGTKETVHWLLHDICPELVRGLLQTGKSELEKQVKPEAWLSSGPSPGP
GHLLLVCHVSGFYPKPVXVMWMRGEQEEPGTRQGDVMPNADSTWYLRVTLDVAAGEAAGL
SCRVKHSSLGDQDIILYWDGNRVSRGLIVALVLLVFVLLFVGGLVFWFRKHRRYQDIP
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgagtggaaccggggattcccggaagaggtckgcgagagggagccgagcagggaaaggg
gaggacgctmgcggcgggcgggcgcagactgatgcacctcgsaaagccgggagcttgatc
cascagcycgagaacctgctactccctgcctccagctgcttggcycctggagaccgagct
cgattcagagcgagcagacatcaccctttcttcccaaacctaactrtttctttctttctt
ttttttttccttttcccttctgtgctctccctcccgtttccccggctcctcsgatctgta
ttctctccagmcccgcaaacgcctttctccttccacggcctccagatctcctccttggcc
aacagcagctggacacgcacggactgcctggggtggctgggggagctgcagccctatact
tggcgcaatgartcggacaccatccgcttcctgaagccttggtctcggggcacattcagc
gaccagcagtgggagcagctgcagcatacgtttcaggtttatcgcagcagcttcacaaag
gtcctctgggaattcgtcaaaaggctgcacgccgaatatccacttgagatccaggtatct
ggaggatgtgagttactcccgaggaacatctcagaaagcttcttacgygcagcatttcaa
ggaarggatgtcctgagtttccaaggaatgtcttgggtgtcagccccagatgccccgcct
ttgatcgaggaggtcatcaaggtgctcaatcagraccaagggaccaaggaaacagtgcac
tggctcctccatgacatctgccccgagttggtcagaggcctcttgcagaccgggaagtcc
gagytggagaagcaagtgaagccggaggcttggctgtccagtggccccagtcctgggcct
ggccatctgctgctggtgtgccacgtctcaggattctacccaaaacctgtgygggtgatg
tggatgaggggcgagcaggaggagcctggcactcggcaaggagacgtcatgcccaatgcc
gactcgacttggtatctgcgagtaaccctggatgtkgcggctggggaggcagctggcctg
agttgccgagtgaagcacagcagtctaggagaccaggacatcatcctgtactgggatggg
aaccgtgtctccaggggcttgattgttgccctggtactactggtgttcgtccttctgttt
gttggaggcttagtcttctggtttaggaagcaccgccgctatcaagatatcccgtga

DBGET integrated database retrieval system