KEGG   Bos indicus (zebu cattle): 109556827
Entry
109556827         CDS       T04792                                 

Gene name
PRKACB
Definition
(RefSeq) LOW QUALITY PROTEIN: cAMP-dependent protein kinase catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04020  Calcium signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04114  Oocyte meiosis
biu04140  Autophagy - animal
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04310  Wnt signaling pathway
biu04340  Hedgehog signaling pathway
biu04371  Apelin signaling pathway
biu04530  Tight junction
biu04540  Gap junction
biu04611  Platelet activation
biu04713  Circadian entrainment
biu04714  Thermogenesis
biu04720  Long-term potentiation
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04727  GABAergic synapse
biu04728  Dopaminergic synapse
biu04740  Olfactory transduction
biu04742  Taste transduction
biu04750  Inflammatory mediator regulation of TRP channels
biu04910  Insulin signaling pathway
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04913  Ovarian steroidogenesis
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04919  Thyroid hormone signaling pathway
biu04921  Oxytocin signaling pathway
biu04922  Glucagon signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04924  Renin secretion
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04961  Endocrine and other factor-regulated calcium reabsorption
biu04962  Vasopressin-regulated water reabsorption
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04976  Bile secretion
biu05012  Parkinson disease
biu05020  Prion disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05032  Morphine addiction
biu05034  Alcoholism
biu05146  Amoebiasis
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109556827 (PRKACB)
   04014 Ras signaling pathway
    109556827 (PRKACB)
   04310 Wnt signaling pathway
    109556827 (PRKACB)
   04340 Hedgehog signaling pathway
    109556827 (PRKACB)
   04371 Apelin signaling pathway
    109556827 (PRKACB)
   04020 Calcium signaling pathway
    109556827 (PRKACB)
   04024 cAMP signaling pathway
    109556827 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109556827 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    109556827 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109556827 (PRKACB)
   04540 Gap junction
    109556827 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109556827 (PRKACB)
   04062 Chemokine signaling pathway
    109556827 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    109556827 (PRKACB)
   04910 Insulin signaling pathway
    109556827 (PRKACB)
   04922 Glucagon signaling pathway
    109556827 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    109556827 (PRKACB)
   04912 GnRH signaling pathway
    109556827 (PRKACB)
   04913 Ovarian steroidogenesis
    109556827 (PRKACB)
   04915 Estrogen signaling pathway
    109556827 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    109556827 (PRKACB)
   04921 Oxytocin signaling pathway
    109556827 (PRKACB)
   04926 Relaxin signaling pathway
    109556827 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    109556827 (PRKACB)
   04918 Thyroid hormone synthesis
    109556827 (PRKACB)
   04919 Thyroid hormone signaling pathway
    109556827 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    109556827 (PRKACB)
   04916 Melanogenesis
    109556827 (PRKACB)
   04924 Renin secretion
    109556827 (PRKACB)
   04925 Aldosterone synthesis and secretion
    109556827 (PRKACB)
   04927 Cortisol synthesis and secretion
    109556827 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109556827 (PRKACB)
   04270 Vascular smooth muscle contraction
    109556827 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    109556827 (PRKACB)
   04971 Gastric acid secretion
    109556827 (PRKACB)
   04976 Bile secretion
    109556827 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109556827 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109556827 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    109556827 (PRKACB)
   04727 GABAergic synapse
    109556827 (PRKACB)
   04725 Cholinergic synapse
    109556827 (PRKACB)
   04728 Dopaminergic synapse
    109556827 (PRKACB)
   04726 Serotonergic synapse
    109556827 (PRKACB)
   04720 Long-term potentiation
    109556827 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    109556827 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    109556827 (PRKACB)
   04742 Taste transduction
    109556827 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    109556827 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    109556827 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    109556827 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109556827 (PRKACB)
   04714 Thermogenesis
    109556827 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109556827 (PRKACB)
   05205 Proteoglycans in cancer
    109556827 (PRKACB)
   05203 Viral carcinogenesis
    109556827 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109556827 (PRKACB)
   05020 Prion disease
    109556827 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    109556827 (PRKACB)
   05031 Amphetamine addiction
    109556827 (PRKACB)
   05032 Morphine addiction
    109556827 (PRKACB)
   05034 Alcoholism
    109556827 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109556827 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109556827 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109556827 (PRKACB)
   05163 Human cytomegalovirus infection
    109556827 (PRKACB)
   05165 Human papillomavirus infection
    109556827 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109556827 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109556827 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109556827 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:biu03019]
    109556827 (PRKACB)
   03036 Chromosome and associated proteins [BR:biu03036]
    109556827 (PRKACB)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     109556827 (PRKACB)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: AGC group
  PKA family
   109556827 (PRKACB)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     109556827 (PRKACB)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109556827 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 109556827
NCBI-ProteinID: XP_019813789
UniProt: A0A6P5BQ55
LinkDB
Position
3
AA seq 391 aa
MAAYREVPCNQYTGTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSFSVRGVSPVFKKSLSGNLDMGLPVRYLGTSFQPFRSSPFLLLVIGITVYPDTQA
KNIVMIAIWCGLSXGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPS
HFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFR
GSGDTSNFDDYEEEDIRVSITEKCGKEFCEF
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggcagcttacagagaagtaccctgtaaccaatatacaggtactactgctcttcagaaa
ttggaaggttttgctagccgattatttcatagacactccaaaggtactgcacatgatcag
aaaacagctctggaaaatgacagccttcatttctctgaacatactgccttatgggacaga
tcaatgaaagagtttctagccaaagccaaagaagactttttaaaaaaatgggaaaatcct
gctccgaataatgctgggctggaggattttgaaaggaaaaaaacccttggaacaggttca
tttggaagagtcatgttggtgaaacacaaagccactgaacagtattatgccatgaagatc
ttagataagcagaaggttgttaaactgaagcaaatagagcatactttgaatgagaaaaga
atattacaggcagtgaattttccttttcttgttcgactggaatatgcttttaaggataat
tctaatttatacatggttatggaatatgttcctggtggtgaaatgttttcacatctaaga
agaattggaaggttcagtttctctgttcgtggtgtttccccagtatttaaaaagtcctta
agtggaaatttagatatggggctgcctgtacgttatcttggaacatccttccaacctttt
cgttcttcacccttcctcctcttagttattggcatcactgtttacccagatactcaagcc
aaaaatatagtaatgattgccatttggtgtggtttatcttagggctacaataaggcagtg
gattggtgggcgttaggagtgttaatctatgaaatggcggctggctaccccccattcttt
gcagaccaaccaattcagatttatgaaaaaattgtttctggaaaggttcgattcccttct
cacttcagttcagatctcaaggaccttctaaggaacctgctgcaggtagacttaacaaag
cggtttggaaatctaaagaatggtgtgagtgacataaaaactcacaagtggtttgccaca
acagactggattgctatttaccagagaaaggttgaagctccattcataccaaagttcaga
ggctctggagataccagcaactttgatgactatgaagaagaagatatccgtgtctctata
acagaaaaatgtgggaaagaattttgtgaattttag

KEGG   Bos indicus (zebu cattle): 109561498
Entry
109561498         CDS       T04792                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04020  Calcium signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04114  Oocyte meiosis
biu04140  Autophagy - animal
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04310  Wnt signaling pathway
biu04340  Hedgehog signaling pathway
biu04371  Apelin signaling pathway
biu04530  Tight junction
biu04540  Gap junction
biu04611  Platelet activation
biu04713  Circadian entrainment
biu04714  Thermogenesis
biu04720  Long-term potentiation
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04727  GABAergic synapse
biu04728  Dopaminergic synapse
biu04740  Olfactory transduction
biu04742  Taste transduction
biu04750  Inflammatory mediator regulation of TRP channels
biu04910  Insulin signaling pathway
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04913  Ovarian steroidogenesis
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04919  Thyroid hormone signaling pathway
biu04921  Oxytocin signaling pathway
biu04922  Glucagon signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04924  Renin secretion
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04961  Endocrine and other factor-regulated calcium reabsorption
biu04962  Vasopressin-regulated water reabsorption
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04976  Bile secretion
biu05012  Parkinson disease
biu05020  Prion disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05032  Morphine addiction
biu05034  Alcoholism
biu05146  Amoebiasis
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109561498 (PRKACA)
   04014 Ras signaling pathway
    109561498 (PRKACA)
   04310 Wnt signaling pathway
    109561498 (PRKACA)
   04340 Hedgehog signaling pathway
    109561498 (PRKACA)
   04371 Apelin signaling pathway
    109561498 (PRKACA)
   04020 Calcium signaling pathway
    109561498 (PRKACA)
   04024 cAMP signaling pathway
    109561498 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109561498 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    109561498 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109561498 (PRKACA)
   04540 Gap junction
    109561498 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109561498 (PRKACA)
   04062 Chemokine signaling pathway
    109561498 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    109561498 (PRKACA)
   04910 Insulin signaling pathway
    109561498 (PRKACA)
   04922 Glucagon signaling pathway
    109561498 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    109561498 (PRKACA)
   04912 GnRH signaling pathway
    109561498 (PRKACA)
   04913 Ovarian steroidogenesis
    109561498 (PRKACA)
   04915 Estrogen signaling pathway
    109561498 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    109561498 (PRKACA)
   04921 Oxytocin signaling pathway
    109561498 (PRKACA)
   04926 Relaxin signaling pathway
    109561498 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    109561498 (PRKACA)
   04918 Thyroid hormone synthesis
    109561498 (PRKACA)
   04919 Thyroid hormone signaling pathway
    109561498 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    109561498 (PRKACA)
   04916 Melanogenesis
    109561498 (PRKACA)
   04924 Renin secretion
    109561498 (PRKACA)
   04925 Aldosterone synthesis and secretion
    109561498 (PRKACA)
   04927 Cortisol synthesis and secretion
    109561498 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109561498 (PRKACA)
   04270 Vascular smooth muscle contraction
    109561498 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    109561498 (PRKACA)
   04971 Gastric acid secretion
    109561498 (PRKACA)
   04976 Bile secretion
    109561498 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109561498 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109561498 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    109561498 (PRKACA)
   04727 GABAergic synapse
    109561498 (PRKACA)
   04725 Cholinergic synapse
    109561498 (PRKACA)
   04728 Dopaminergic synapse
    109561498 (PRKACA)
   04726 Serotonergic synapse
    109561498 (PRKACA)
   04720 Long-term potentiation
    109561498 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    109561498 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    109561498 (PRKACA)
   04742 Taste transduction
    109561498 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    109561498 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    109561498 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    109561498 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109561498 (PRKACA)
   04714 Thermogenesis
    109561498 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561498 (PRKACA)
   05205 Proteoglycans in cancer
    109561498 (PRKACA)
   05203 Viral carcinogenesis
    109561498 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109561498 (PRKACA)
   05020 Prion disease
    109561498 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    109561498 (PRKACA)
   05031 Amphetamine addiction
    109561498 (PRKACA)
   05032 Morphine addiction
    109561498 (PRKACA)
   05034 Alcoholism
    109561498 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109561498 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109561498 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109561498 (PRKACA)
   05163 Human cytomegalovirus infection
    109561498 (PRKACA)
   05165 Human papillomavirus infection
    109561498 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109561498 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109561498 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109561498 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:biu03019]
    109561498 (PRKACA)
   03036 Chromosome and associated proteins [BR:biu03036]
    109561498 (PRKACA)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     109561498 (PRKACA)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: AGC group
  PKA family
   109561498 (PRKACA)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     109561498 (PRKACA)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109561498 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 109561498
NCBI-ProteinID: XP_019819561
UniProt: A0A6P5C1U0
LinkDB
Position
7
AA seq 351 aa
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaagaaagcgtgaaagagttctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcctgctcagaacacagcccac
ttggatcagtttgaacgaatcaagaccctgggtacgggctccttcgggcgggtgatgctg
gtgaagcacatggagaccgggaaccactacgccatgaagatcctcgacaaacagaaggtg
gtgaagctgaaacagattgagcacaccctgaatgagaagcgcatcctgcaggcggtcaac
tttccgttccttgtcaaactcgagttctccttcaaggacaactcaaatttatacatggtc
atggagtacgtgcccggtggggagatgttytcacacctgcgacggatcgggaggttcagt
gagccccacgcacgcttctacgccgcccagattgtcctgacctttgagtacctgcactcg
cttgatctcatctaccgggacctgaagccagagaacctcctcatcgaccagcagggctac
attcaggtgacagactttggtttcgccaagcgtgtgaaaggccgcacctggaccttgtgt
gggacccccgagtacttggcccccgagatcatcctgagtaaaggctacaacaaagctgtg
gactggtgggccctgggggtcctcatctacgaaatggccgcaggctacccgcccttcttt
gccgaccagcccatccagatctacgagaagattgtctctgggaaggtgcggtttccatcc
cacttcagctctgacttgaaggatctgctgcgcaacctcctacaagtggacctcaccaag
cgctttgggaacctcaagaatggggtcaatgatatcaagaaccacaagtggtttgccaca
actgactggattgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacaagtaactttgacgactatgaggaggaagagatccgagtctctatc
aatgagaagtgtggcaaggagttttctgagttctag

DBGET integrated database retrieval system