KEGG   Bos indicus (zebu cattle): 109556936Help
Entry
109556936         CDS       T04792                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04371  Apelin signaling pathway
biu05034  Alcoholism
biu05165  Human papillomavirus infection
biu05169  Epstein-Barr virus infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109556936 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    109556936 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    109556936 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    109556936 (HDAC4)
   05165 Human papillomavirus infection
    109556936 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109556936 (HDAC4)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109556936 (HDAC4)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109556936 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 109556936
NCBI-ProteinID: XP_019813859
LinkDB All DBs
Position
3
AA seq 1000 aa AA seqDB search
MKPTQSSTRPPSQPSIHPPSQQSIHPSTLPVIHSSTQSAVHPSSQKTQHSSLDQSSPPQS
GASASYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTA
LKKRPLDVTDSACSSAPGSAPSSPNNSSGNVSTENGIAPAVPSIPAETSLAHRLVAREGS
VGPLPLYTSPSLPNITLGLPATGPSTGAAGQQEAERLALPALQQRISLFPGTHLAPYLGA
APLERDAGAAPGSLLQHVVLLEQPPTQTPLVTDRYLAGLGALPLHAQPLVGAERVAPSVH
KLRQHRPLGRTQSAPLPQSTQALQHLVIQQQHQQFLEKHKQHFQQPQLHLNKMIPKPSEP
ARQPESHPEETEEELREHQALLEEPFLDRLPGQKETHTLAGVQVKQEPIESDDEETEPPR
EAEPGQRPPTEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSP
ASATFPMSVQEPPAKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGL
RGKCECIRGRKATLEELQTVHSETHALLYGTNPLNRQKLDSSLTSVFVRLPCGGVGVDSD
TIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVA
IAAKLLQQRLSVSKTLVVDWDVHHGNGTQQAFYSDPRVLYISLHRYDDGNFFPGSGAPDE
VGTGAGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGH
PTPLGGYNLSAKCFGYLTKQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNELDP
LPEKVLQQRPNANAVRSMEKVIEIHSQYWRSLQRLASTAGYSLVEAQKCENEEAETVTAM
ASLSVAVKAPEKSHVAGPXLGAAGLNFEACGXGEPGSSLPEALGALAGGQQVSTLYPFAG
NPVMPRTSCPPALRAFQLRLRAPEPHQQAAVPRPPPAAWD
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccacccagtcatccactcgtccacccagtcagccgtccatccatcctcccagt
cagcagtccatccatccctccacactcccagtcatccactcgtccacccagtcagccgtc
catccatcctcccagaagacgcagcacagctcgctggaccagagctccccgccccagagc
ggggcgtcagcctcctacaaccacccagtcctgggcatgtatgacgccaaagacgacttc
cccctcagaaagacagcttctgaacccaacctgaaattacgctccaggctaaagcagaaa
gtggctgagagacggagcagccccctgctacgcaggaaagatgggccagtggtcacggct
ctgaaaaagcgtcccttggatgtcacagactcggcgtgcagcagtgccccaggctccgcg
cccagctcrcccaacaacagctccgggaacgtgagcacggagaacgggatcgcgcccgcc
gtccccagcatcccrgccgagaccagcctggcacacagactcgtggcacgagagggctcg
gtgggtccgctgcccctctacacgtcaccatccctgcccaacatcacactggggctgccc
gccaccggcccctccacgggggcggccggccagcaggaggccgagagactggccctcccc
gccctgcagcagcgcatctccctcttccctggtacccacctcgccccctacctgggcgca
gcgcctctggagcgggacgcgggggcagccccgggctccctcttgcagcatgtggtcctc
ctggagcagccgcccacgcagacgcccctcgtcacagaccgctaccttgcaggcctgggc
gcgctgcccctgcacgcgcagcccctggtaggggcggagcgagtggcsccctcggtgcac
aagctgcggcagcaccgcccgctgggccgcacgcagtcggcgccgctgccccagagcacg
caggcgctgcagcacctggtcatccagcagcagcaccagcagttcctggagaagcacaag
cagcacttccagcagccgcagctgcacctcaacaagatgatccccaaacccagcgagccr
gcccggcagccygagagccaccccgaggagacagaggaggagctgcgggagcaccaggcg
ctcctggaggagcccttcctggaccggctcccagggcagaaggagacccacacactggcc
ggggtgcaggtgaagcaggagcccatcgagagtgatgacgaggagacggagcccccgmgg
gaggcggagcccggccagcggccgcccacagagcaggagctgctcttcagacagcaagcc
ctcctcctggagcagcagcggatccaccagctgaggaactaccaggcgtccatggaggct
gctggcatccccgtgtcctttggcgggcaccggcccctgtcccgggcacagtcctccccc
gcatccgccaccttccccatgtccgtgcaggagcccccagccaagccaaggttcaccaca
ggcctcgtgtacgacactctgatgctgaaacaccagtgcacttgcgggaacaccaacagc
cacccagagcaygccgggcgcatccagagcatctggtcgcggctgcaggagaccggcctg
cgaggcaaatgtgagtgcatccgcggacgtaaggccacgctggaggagctgcagacagtg
cactcggagacacacgccctgctgtacggcacgaaccccctcaacaggcagaaactggac
agctcactaacgtccgtgttcgtcaggctgccctgcggtggtgtcggggtggacagtgac
accatatggaacgaggtgcactcgtcgggggccgcccgcctggccgtgggctgtgtggta
gagctggtcttcaaggtggccacgggggagctgaagaatggctttgctgtggtccgccct
ccaggacaccacgcagaggagagcacgcccatggggttctgctacttcaactccgtagcc
atcgctgccaagcttctccagcaaaggctgagcgtgagcaagaccctcgtggtggactgg
gatgtgcaccatgggaacggaacccagcaggccttctacagcgacccccgcgtgctctac
atctccctgcaccgctacgacgacggcaacttcttcccgggcagcggcgcgcctgacgag
gtgggcacgggcgccggcgtgggctttaacgtcaacatggctttcaccggcggcctggac
ccccccatgggagacgcagagtacctcgcagccttcaggaccgtggtcatgccgatcgcc
agcgagttcgccccggacgtggtgctggtgtcctcgggcttcgatgccgtggagggccac
cccacgcccctcggaggctacaacctctccgccaagtgtttcgggtacctgacaaagcag
ctgatgggcctggccggcggccgggttgtcctggcgctggaggggggccacgatctcaca
gccatctgcgacgcctcggaagcctgcgtctctgccctgctggggaatgagctcgatcct
ctcccagaaaaggtcttacagcagagacccaatgccaacgcygtgcggtcgatggagaag
gtcattgaaatccacagccagtactggcgctccctgcagaggcttgcctccaccgctggc
tactccctagtcgaggcccagaagtgtgagaacgaggaagccgagactgttactgccatg
gcctcgctgtctgtggcggtgaaggcccctgagaagagccacgtggcagggccctgkctg
ggagcagcaggcctgaactttgaagcctgtggcsgcggggagcctggatcctcgctgcct
gaggccttgggggcgctggccgggggtcagcaagtgagcactttatacccctttgcagga
aaccccgtgatgccgcggacctcgtgtccccctgccctccgggccttccagctgcgcctc
cgggcgccygagccccaccagcaggcagccgtcccccggccgcccccggccgcctgggac
tag

DBGET integrated database retrieval system