KEGG   Bos indicus (zebu cattle): 109556945Help
Entry
109556945         CDS       T04792                                 

Gene name
NEU4
Definition
(RefSeq) sialidase-4
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00511  Other glycan degradation
biu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    109556945 (NEU4)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    109556945 (NEU4)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     109556945 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Transglut_core3
Motif
Other DBs
NCBI-GeneID: 109556945
NCBI-ProteinID: XP_019813869
LinkDB All DBs
Position
3
AA seq 478 aa AA seqDB search
MGTPRVPARTVLFQRERTGLTYRVPALLFAPPGPTLLAFAEQRLSPDDAHAHRLVQRTGT
LAGGSVRWGAPRVLGTAALDEHRSMNPCPVHDERTATVFLFFIAVRGRTPEAAQIASGRN
AARLCCVTSRDAGRSWGGARDLTAEAVGSAEQDWATFAVGPGHGVQLRSGRLLVPAYTYH
VVRRECFGRICRTRPQSFAFYSDDHGRTWQRGGLVPSLRSGECQLAAVDGGRAGGVLYCN
ARSPLGSRVQALSVDEGTSFLPGELVPALAETARGCQGSIVGFPAPPASGWKDEGWSAGT
SNPLRLPHLCPGAREAPEEGTXDTRGGGGLGGMEGCGNGPREPGENWGSWASVLXGPLAA
LSQSPTWLLYSHPVGRRARLHMGVRLSRSPLDPHSWTEPWVIHQGPSGYSDLASIGPAPG
GVPTFACLFESGARVSYEEISFCMFSLQEVLENVRLGGVHPGPGDKPGDKPAGRCQPS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggggaccccgcgtgtccccgcgcggaccgtccttttccagcgcgagcggacgggcctg
acctaccgcgtgcccgcgctgctcttcgcgccccccgggcccaccctgctggccttcgcg
gagcagaggctcagccccgacgacgcccacgcccaccgtctggtgcagaggaccggcacg
ctagccgggggctccgtgcggtggggcgccccgcgcgtgctggggacggcggccctggac
gagcaccgctccatgaacccctgcccggtgcacgatgagcgcacggccacggtcttcctc
ttcttcatcgccgtgcgtggccgcacccccgaggccgcgcagatcgcctcgggcaggaac
gccgcgcgcctctgctgcgttaccagccgggacgcggggcgcagctggggcggcgcgcgg
gacctcacggcggaggcggtgggcagcgctgagcaggactgggccacgtttgccgtgggg
cctggccacggcgtgcagttgcgctctggccgcctgctggtgccggcctacacctaccac
gtggtccggcgggagtgcttcggccggatctgcaggacccgcccccagtccttcgcgttc
tacagtgatgaccacggccgcacctggcagcgcgggggcctcgtgcccagcctgcgctcg
ggcgagtgccagctggccgcggtggacggcgggcgggccggtggcgtcctctactgcaat
gctcggagccccctgggcagccgcgtgcaggccctcagcgtggacgagggcacctccttc
ctgcccggggagctggtgcctgccctggccgagaccgcccggggctgccagggcagcatc
gtgggcttcccggccccacccgccagcgggtggaaggatgaggggtggtccgcgggcacc
agcaacccyctccgccttccgcacctctgtcctggggccagggaggccccagaggagggc
actgragacacccgtgggggcggggggctgggtgggatggagggctgtggcaacggcccc
agggagcctggtgagaactggggctcctgggcctcagtgctccygggacctcttgcagcc
ttgtcgcagagccccacgtggttgctgtactcccacccagtggggcgcagggctcggctc
cacatgggtgtccgcctgagccggtccccgctggacccccacagctggacggagccctgg
gtcatccaccagggccccagtggctactcggacctggcatccatcgggcctgcccctggg
ggcgtcccgaccttcgcctgtctgttcgagagtggggccagggtctcctatgaggagatc
tccttctgcatgttttccctgcaggaggtcctggagaacgtgaggctagggggagtgcac
cccggccctggagacaagcctggagacaagcctgcggggcgctgccagccctcctga

DBGET integrated database retrieval system