KEGG   Bos indicus (zebu cattle): 109557333
Entry
109557333         CDS       T04792                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin isoform X1
  KO
K06854  thrombopoietin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109557333 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109557333 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109557333 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109557333 (THPO)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109557333 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 109557333
NCBI-ProteinID: XP_019814160
UniProt: A0A6P5BQH9
LinkDB
Position
1
AA seq 353 aa
MELTELLLVVILLLTARITLSSPAPPACDPRLLNKLLRDSHVLHSRLSQCPDVNPLSTPV
LLPAVDFSLGEWKTQTEQTKAQDVLGTTTLLLEAVMTARGQLGPTCLSSLLVQLSGQVRL
LLGALQGLLGTQLPPQGRTTAHKDPSAIFLSFQQLLRGKVRFLLLVVGPSLCAKRAPPAT
AVPGSISPLLTLNKLPNRTSGLLETNSSVSARTTGFGLPNRLQGFRAKIPGLLNQTSRSL
GQIPGHLNGTQGPLSGVHGLFPGPSPRALGAPDIPLGTSDMGSLPPYLQPGDSPSPAHPP
PGQYTLFSPSPTSPIPTVHLQPLLPDPSAITPNSSSSLLVAAHSHFRNLSQEE
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggagctgactgaattgctcctcgtggtcatccttctcctaactgcaagaataactctg
tccagcccggctcctcctgcctgtgacccccgactcctaaataaactgcttcgtgactcc
catgtccttcacagcagactgagccagtgtccagacgttaaccctttgtccacacctgtc
cttctgcctgctgtggacttcagcttgggagaatggaaaacccagacggagcagaccaaa
gcacaggacgtcctgggaaccacgacccttctgctggaggcagtgatgacagcgcgggga
cagctgggccccacttgcctctcatccctcctggtgcagctttctgggcaggtccgcctc
cttcttggggccctgcagggcctcctaggaacccagcttcctccacagggcaggaccaca
gctcacaaggatcccagtgccatcttcctgagcttccaacagctgctccgaggaaaggtg
cgcttcctgctgcttgtagtggggcccagcctctgtgccaagcgggccccacccgccaca
gctgtcccgggcagcatctctccattgctcacactgaacaagctcccaaacaggacttct
ggattgttggagaccaactccagtgtctcagccagaactactggctttggacttccgaac
aggctgcaaggattcagagccaagattcctggtctgctgaaccaaacctccaggtcctta
ggccaaatccctggacacctgaacgggacacaaggacccttaagtggagttcatggactc
tttcctgggccctcacccagggccctaggagccccggatattcctctgggaacttcagac
atgggctccctgccaccctacctccagcctggagattctccttccccagcccatcctccc
cctggacaatacacactcttctctccttcgccaacctcacccatccccacggtccacctc
caacccctgcttcctgacccctcagccatcacacccaactcttccagttctcttctagtt
gcagcccactctcacttccggaatctgtctcaggaagagtaa

DBGET integrated database retrieval system