KEGG   Bos indicus (zebu cattle): 109557333
Entry
109557333         CDS       T04792                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin isoform X1
  KO
K06854  thrombopoietin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109557333 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109557333 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109557333 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109557333 (THPO)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109557333 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 109557333
NCBI-ProteinID: XP_019814160
UniProt: A0A6P5BQH9
LinkDB
Position
1
AA seq 353 aa
MELTELLLVVILLLTARITLSSPAPPACDPRLLNKLLRDSHVLHSRLSQCPDVNPLSTPV
LLPAVDFSLGEWKTQTEQTKAQDVLGTTTLLLEAVMTARGQLGPTCLSSLLVQLSGQVRL
LLGALQGLLGTQLPPQGRTTAHKDPSAIFLSFQQLLRGKVRFLLLVVGPSLCAKRAPPAT
AVPGSISPLLTLNKLPNRTSGLLETNSSVSARTTGFGLPNRLQGFRAKIPGLLNQTSRSL
GQIPGHLNGTQGPLSGVHGLFPGPSPRALGAPDIPLGTSDMGSLPPYLQPGDSPSPAHPP
PGQYTLFSPSPTSPIPTVHLQPLLPDPSAITPNSSSSLLVAAHSHFRNLSQEE
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggagctgactgaattgctcctcgtggtcatccttctcctaactgcaagaataactctg
tccagcccggctcctcctgcctgtgacccccgactcctaaataaactgcttcgtgactcc
catgtccttcacagcagactgagccagtgtccagacgttaaccctttgtccacacctgtc
cttctgcctgctgtggacttcagcttgggagaatggaaaacccagacggagcagaccaaa
gcacaggacgtcctgggaaccacgacccttctgctggaggcagtgatgacagcgcgggga
cagctgggccccacttgcctctcatccctcctggtgcagctttctgggcaggtccgcctc
cttcttggggccctgcagggcctcctaggaacccagcttcctccacagggcaggaccaca
gctcacaaggatcccagtgccatcttcctgagcttccaacagctgctccgaggaaaggtg
cgcttcctgctgcttgtagtggggcccagcctctgtgccaagcgggccccacccgccaca
gctgtcccgggcagcatctctccattgctcacactgaacaagctcccaaacaggacttct
ggattgttggagaccaactccagtgtctcagccagaactactggctttggacttccgaac
aggctgcaaggattcagagccaagattcctggtctgctgaaccaaacctccaggtcctta
ggccaaatccctggacacctgaacgggacacaaggacccttaagtggagttcatggactc
tttcctgggccctcacccagggccctaggagccccggatattcctctgggaacttcagac
atgggctccctgccaccctacctccagcctggagattctccttccccagcccatcctccc
cctggacaatacacactcttctctccttcgccaacctcacccatccccacggtccacctc
caacccctgcttcctgacccctcagccatcacacccaactcttccagttctcttctagtt
gcagcccactctcacttccggaatctgtctcaggaagagtaa

KEGG   Bos indicus (zebu cattle): 109557596
Entry
109557596         CDS       T04792                                 

Gene name
LEP
Definition
(RefSeq) leptin isoform X1
  KO
K05424  leptin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04152  AMPK signaling pathway
biu04630  JAK-STAT signaling pathway
biu04920  Adipocytokine signaling pathway
biu04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109557596 (LEP)
   04152 AMPK signaling pathway
    109557596 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109557596 (LEP)
   04060 Cytokine-cytokine receptor interaction
    109557596 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109557596 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109557596 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109557596 (LEP)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109557596 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 109557596
NCBI-ProteinID: XP_019814592
UniProt: A0A6P5BKJ7
LinkDB
Position
4
AA seq 192 aa
MEPRRDRGIAAPAAARPQKPIPGRKMRCGPLYRFLWLWPYLSYVEAVPIRKVQDDTKTLI
KTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILTSLPSRNVV
QISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQ
DMLRQLDLSPGC
NT seq 579 nt   +upstreamnt  +downstreamnt
atggagccccggagggatcgaggaatcgcggcgccagcagcggcgaggccccagaagccc
atcccgggaaggaaaatgcgctgtggacccctgtatcgattcctgtggctttggccctat
ctgtcttacgtggaggctgtgcccatccgcaaggtccaggatgacaccaaaaccctcatc
aagacaattgtcaccaggatcaatgacatctcacacacgcagtccgtctcctccaaacag
agggtcactggtttggacttcatccctgggctccaccctctcctgagtttgtccaagatg
gaccagacattggcgatctaccaacagatcctcaccagtctgccttccagaaatgtggtc
caaatatccaatgacctggagaacctccgggaccttctccacctgctggccgcctccaag
agctgccccttgccgcaggtcagggccctggagagcttggagagcttgggcgtcgtcctg
gaagcytccctctactccaccgaggtggtggccctgagccggctgcaggggtcactacag
gacatgttgcggcagctggacctcagtcctgggtgctga

KEGG   Bos indicus (zebu cattle): 109569574
Entry
109569574         CDS       T04792                                 

Gene name
CNTF
Definition
(RefSeq) ciliary neurotrophic factor isoform X1
  KO
K05420  ciliary neurotrophic factor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109569574 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109569574 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109569574 (CNTF)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109569574 (CNTF)
SSDB
Motif
Pfam: CNTF FGase
Other DBs
NCBI-GeneID: 109569574
NCBI-ProteinID: XP_019830627
UniProt: A0A6P5D0Q2
LinkDB
Position
15
AA seq 199 aa
MAFAEHSLLPPHRRDLCSRSIWLARKIRSDLTALVDSYMKHQGLNGNMNLDTLEGVPTAS
SSRWSELTEAERLQENLQAYRAFHGMLARLLEDQRAHFTPAEEDFHQAIHAVLLQVAAFT
YQLEELMVLLEHRVPPREAGGPPLLPGDAGLFEKKLWGLKVLQELSRWTVRSVHDLRTIS
RQSGVPACGSRCATKDKRM
NT seq 600 nt   +upstreamnt  +downstreamnt
atggctttcgcggagcattcgctgctcccccctcaccgccgggacctgtgtagccgctcc
atctggctagcacggaagatccgttcagacctgactgctctggtggactcttacatgaag
catcagggtctgaacgggaacatgaacctggacactctggaaggcgtgccgacggccagc
tccagcaggtggagcgagctgactgaggcggagcggctccaagagaacctccaggcctac
cgcgccttccacgggatgttggcccggctgttggaagaccagcgggcacacttcaccccg
gccgaagaagacttccaccaggcgatacacgctgtcctcctccaggtggcggccttcacg
taccagctggaggagttgatggtgctgctggagcacagggtgccccccagggaggccggc
gggccgcccctcctccctggggacgctggtctctttgagaagaagctgtggggcctgaag
gtgctgcaggagctttctcggtggacggtgaggtccgtgcatgacctgaggaccatctct
cgacaaagtggggtccccgcatgtgggagccgttgtgccaccaaggacaagagaatgtag

KEGG   Bos indicus (zebu cattle): 109573417
Entry
109573417         CDS       T04792                                 

Gene name
CSF3
Definition
(RefSeq) granulocyte colony-stimulating factor isoform X1
  KO
K05423  granulocyte colony-stimulating factor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04657  IL-17 signaling pathway
biu05144  Malaria
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109573417 (CSF3)
   04151 PI3K-Akt signaling pathway
    109573417 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109573417 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109573417 (CSF3)
   04657 IL-17 signaling pathway
    109573417 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    109573417 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    109573417 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109573417 (CSF3)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109573417 (CSF3)
SSDB
Motif
Pfam: GCSF IL11
Other DBs
NCBI-GeneID: 109573417
NCBI-ProteinID: XP_019836194
UniProt: A0A6P5DF10
LinkDB
Position
19
AA seq 230 aa
MKLMGECLGPGRGELRQQRAGVPGLPERSALLLSPHLLSVLQLLLWHSALWTVHEATPLG
PARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHKLCHPEELMLLRHSLGIPQAPLSSC
SSQSLQLTSCLNQLHGGLFLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMEDL
GAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELAYRGLRYLAEP
NT seq 693 nt   +upstreamnt  +downstreamnt
atgaagctgatgggtgagtgtctgggtcctgggaggggagagctgcggcagcagcgggca
ggggtgcctgggcttccagaaaggtctgcacttctcctgagcccccatctgctctcagtc
ctgcagctgctcctctggcacagtgcgctctggacggtgcacgaagccaccccccttggc
cctgcccgatccctgccccagagcttcctgctcaagtgyttagagcaagtgaggaaaatc
caggctgatggcgccgagctgcaggagaggctgtgtgccgcccacaagctgtgccacccg
gaggagctgatgctgctcaggcactctctgggcatcccccaggctcccctaagcagctgc
tccagccagtccctgcagctgacgagctgcctgaaccaactacacggcggcctctttctc
taccagggcctcctgcaggccctggcgggcatctccccagagctggcccccaccttggac
acactgcagctggacgtcactgactttgccacgaacatctggctgcagatggaggacctg
ggggcggcccccgctgtgcagcccacccagggcgccatgccgaccttcacttcagccttc
caacgcagagcaggaggggtcctggttgcttcccagctgcatcgtttcctggagctggca
taccgtggcctgcgctaccttgctgagccctga

KEGG   Bos indicus (zebu cattle): 109574543
Entry
109574543         CDS       T04792                                 

Definition
(RefSeq) somatotropin
  KO
K05438  growth hormone
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109574543
   04151 PI3K-Akt signaling pathway
    109574543
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109574543
   04060 Cytokine-cytokine receptor interaction
    109574543
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    109574543
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109574543
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109574543
SSDB
Motif
Pfam: Hormone_1 XTBD
Other DBs
NCBI-GeneID: 109574543
NCBI-ProteinID: XP_019838159
UniProt: A5YVX0
LinkDB
Position
19
AA seq 217 aa
MMAAGPRTSLLLAFALLCLPWTQVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFER
TYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLS
RVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDA
LLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
NT seq 654 nt   +upstreamnt  +downstreamnt
atgatggctgcaggcccccggacctccctgctcctggctttcgccctgctctgcctgccc
tggactcaggtggtgggcgccttcccagccatgtccttgtccggcctgtttgccaacgct
gtgctccgggctcagcacctgcaccagctggctgctgacaccttcaaagagtttgagcgc
acctacatcccggagggacagagatactccatccagaacacccaggttgccttctgcttc
tctgaaaccatcccggcccccacgggcaagaatgaggcccagcagaaatcagacttggag
ctgcttcgcatctcactgctcctcatccagtcgtggcttgggcccctgcagttcctcagc
agagtcttcaccaacagcttggtgtttggcacctcggaccgtgtctatgagaagctgaag
gacctggaggaaggcatcctggccctgatgcgggagctggaagatggcaccccccgggct
gggcagatcctcaagcagacctatgacaaatttgacacaaacatgcgcagtgacgacgcg
ctgctyaagaactacggtctgctctcctgcttccggaaggacctgcataagacggagacg
tacctgcgggtcatgaagtgccgccgcttcggggaggccagctgtgccttctag

KEGG   Bos indicus (zebu cattle): 109576744
Entry
109576744         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: chorionic somatomammotropin hormone 2-like
  KO
K05439  prolactin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109576744
   04151 PI3K-Akt signaling pathway
    109576744
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109576744
   04060 Cytokine-cytokine receptor interaction
    109576744
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109576744
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109576744
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109576744
SSDB
Motif
Pfam: Hormone_1 DUF3292
Other DBs
NCBI-GeneID: 109576744
NCBI-ProteinID: XP_019840933
UniProt: A0A6P5DRD5
LinkDB
Position
23
AA seq 163 aa
MDRKKEKYAQGKQYYINATKSCNTNFFHTPEERDRAHQMNNEDLIKWTLVLLYSWNKPLY
HLVTKLWSIKXVSEAFLSSAMENKNMSEKLQAFIESQFRKIIVPVLQTMHKVRITWSGLP
SLTSSDEDRCLSEFYNLFHCLSRDSRKVDMYIKILTCRIRKTC
NT seq 492 nt   +upstreamnt  +downstreamnt
atggacagaaagaaagaaaaatatgcccagggcaaacagtactatatcaatgccaccaag
agctgcaacaccaatttcttccatactcccgaggaaagagatagagcccaccagatgaac
aatgaagaccttattaagtggacactcgtgttactgtactcctggaataaacctctgtat
catctagtcacgaagctttggagtataaaanatgtttcagaggctttcctatcaagtgct
atggagaataagaacatgtcagagaaacttcaagcattcatagagagtcaattcaggaag
attatcgttccagtcttacagacgatgcacaaggttcgcattacctggtcaggactccca
tccctgacgtccagtgatgaagataggtgtctttctgaattttataacctgttccactgc
ctgagcagggattcacgtaaagttgacatgtacatcaagatcctgacgtgccgaatccgc
aaaacttgctaa

KEGG   Bos indicus (zebu cattle): 109576772
Entry
109576772         CDS       T04792                                 

Definition
(RefSeq) placental prolactin-related protein 1 isoform X1
  KO
K05439  prolactin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109576772
   04151 PI3K-Akt signaling pathway
    109576772
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109576772
   04060 Cytokine-cytokine receptor interaction
    109576772
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109576772
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109576772
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109576772
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 109576772
NCBI-ProteinID: XP_019840956
UniProt: A0A6P5DRS8
LinkDB
Position
23
AA seq 278 aa
MASWLSLRSIPCSRFPPSHPIRLTPHXQQESSPWDHSTIPMAPAPSFRGHQWTYNPVRGS
CLLLLLLMSNLLLCQGKSCPSCGPDVFVSLRKSFTDRFMNAASLSHDFXNLSTIMFNEFD
EKYAQGKLYYINVTKSCHTNSFHAPEERDIVQQTNIEDLSKWTLVLLYSWNNPLHHLVTE
LQHMKELSNXFLSSATRFENMSEKLQAFIERQFXKIIVPVLNTMIQARSSWTGLPSLMSS
DEDRRHSEFYNLFYCLRRDSRKVDMYIKILTCRTHKTC
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcctcatggctttccttaagaagcattccatgcagcagatttcctccatcccatccc
atcaggctgactccccackgtcaacaggagtcctcaccctgggatcattccacaatcccc
atggctccagctcccagcttccgtggacaccagtggacttacaaccctgtccgagggtcc
tgcctgctgctgctgctgctcatgtctaatctgctcctgtgccaaggcaaatcatgcccg
tcctgcggtcctgacgtgtttgtctccttacggaaatcctttacagacaggtttatgaat
gccgccagcctctcccatgacttcyataacctttccacaataatgttcaatgagtttgat
gaaaaatatgcccagggcaaactatactatatcaatgtcaccaagagctgccacaccaat
tccttccatgctcccgaagaaagagatatagtccagcagacgaacattgaagaccttagt
aagtggacactcgtgttgctgtactcctggaataatcctctgcatcatctagtcacggag
ctgcagcatatgaaagaactgtcaaackccttcctatcaagcgccacaaggtttgagaac
atgtcagagaaacttcaagcattcatagagcgtcaattcagsaagattattgttccagtc
ttgaatacgatgatccaggctcgcagtagctggacaggactcccatccctratgtccagc
gatgaagataggcgtcattcggaattttataacctgttctactgcctgcgcagggattca
cgtaaagttgacatgtacatcaagatyctgacgtgccgaacccacaaaacgtgctaa

KEGG   Bos indicus (zebu cattle): 109576773
Entry
109576773         CDS       T04792                                 

Definition
(RefSeq) chorionic somatomammotropin hormone 2
  KO
K05439  prolactin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109576773
   04151 PI3K-Akt signaling pathway
    109576773
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109576773
   04060 Cytokine-cytokine receptor interaction
    109576773
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109576773
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109576773
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109576773
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 109576773
NCBI-ProteinID: XP_019840958
UniProt: A0A6P5DRF5
LinkDB
Position
23
AA seq 238 aa
MAPAPSFRGHQWTYNPVRGSCLLLLLLMSNLLLCQGNSCPSCSPDVFVSLRKSLTDLFIN
AASLSHDFHNLSTIMFHKFDEKYAQGKXYYINATKSCHTNSFHTPEEXDKAQQXNNEDLS
KWTLVLLYSWNNPLYXLVTELQSMKEVSEAFLSSAIKIENMSDKLQSFIESQFSKIIVPV
LKMIHEAPSSWSGLPSLTSSDEDRXLSEFYNLFYCLHRDSXKVDTYIKILTCRTRKTC
NT seq 717 nt   +upstreamnt  +downstreamnt
atggctccagctcccagcttccgtggacaccagtggacttacaaccctgtccgagggtcc
tgcctgctgctgctgctgctcatgtctaatctgctcctatgccaaggcaactcatgcccg
tcctgcagtcctgacgtgtttgtctccttacggaaatcccttacagacttgtttatcaat
gccgccagcctctcccaygacttccataacctttccacaataatgttccataagtttgat
gaaaaatatgcccagggcaaacwgtactatatcaatgccaccaagagctgccacaccaat
tccttccatactcccgaagaargagataaagcccagcagaygaacaatgaagaccttagt
aagtggacactcgtgttactgtactcctggaataatcctctgtayyatctagtcacggag
ctgcagagtatgaaagaagtgtcagaggctttcctatcaagcgccataaagattgagaac
atgtcagacaaacttcagtcattcatagagagtcaattcagcaagattattgttccagtc
ttgaagatgatccacgaggctcccagtagctggtcaggactcccatccctgacgtccagc
gatgaagayaggcrtctttctgaattttataacctgttctactgcctgcacagggattca
sgtaaagttgacacgtacatcaagatcctgacgtgccgaacccgcaaaacrtgctaa

KEGG   Bos indicus (zebu cattle): 109576787
Entry
109576787         CDS       T04792                                 

Definition
(RefSeq) chorionic somatomammotropin hormone 1 isoform X1
  KO
K05439  prolactin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109576787
   04151 PI3K-Akt signaling pathway
    109576787
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109576787
   04060 Cytokine-cytokine receptor interaction
    109576787
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109576787
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109576787
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109576787
SSDB
Motif
Pfam: Hormone_1 TRH
Other DBs
NCBI-GeneID: 109576787
NCBI-ProteinID: XP_019840969
UniProt: A0A6P5DSW6
LinkDB
Position
23
AA seq 275 aa
MVARFSSLGIPHHRFPPFSPVGPSPHQQQSSSWDFSPILMAPASSHRGHQWICDLVRGSC
LLLLLVVSNLLLCQGVEDYAPYCKNQPGNCRIPLQSLFERATLVASNNYRLAREMFNEFN
KQFGEGKNFTSKVINSCHTEFMTTPNNKEAAANTEDEALLRLVISLLHSWDEPLHQAVTE
LLHRNGASPDILARAKEIEDKTKVLLEGVEMIQKRVHPGEKKNEPYPVWSEKSSLTADDE
DVRQTAFYRMFHCLHRDSSKISTYINLLKCRFTPC
NT seq 828 nt   +upstreamnt  +downstreamnt
atggttgccaggttttcctccttaggcattccccaccacagatttcctccattcagtcct
gttgggccatctccccatcagcagcagtcctcatcctgggatttctctccaatcctcatg
gctccagcatctagccatcgtgggcaccagtggatttgtgaccttgttcgagggtcctgc
ctgctcctgctgctggtggtgtcaaatctactcttgtgccagggtgtggaggattatgca
ccatactgtaaaaaccaacctggcaactgccggattccccttcaaagcctgtttgagaga
gcaacattggtggctagcaacaactataggctcgccagggaaatgttcaatgaatttaat
aaacagtttggcgagggcaaaaacttcacttccaaggtcatcaacagctgccacaccgaa
ttcatgactacccctaataacaaagaagcagctgcaaatacagaggacgaagccctgttg
aggttggttatcagtttgctccactcgtgggatgaacctctgcatcaggcagtcacagag
ttgttgcacaggaatggagcctcacctgatatcttggcaagggctaaagagattgaggac
aagaccaaagtacttctagaaggtgtggaaatgatacaaaaaagggttcatcctggagag
aagaagaacgagccctatccagtgtggtcagaaaagtcctccctgacagcagacgatgag
gatgtgcgccaaactgccttttatagaatgttccactgcctacacagggattcgagtaaa
attagcacctacatcaatttgcttaagtgccgattcaccccatgctaa

KEGG   Bos indicus (zebu cattle): 109576792
Entry
109576792         CDS       T04792                                 

Definition
(RefSeq) placental prolactin-related protein 4
  KO
K05439  prolactin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109576792
   04151 PI3K-Akt signaling pathway
    109576792
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109576792
   04060 Cytokine-cytokine receptor interaction
    109576792
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109576792
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109576792
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109576792
SSDB
Motif
Pfam: Hormone_1 DUF1968
Other DBs
NCBI-GeneID: 109576792
NCBI-ProteinID: XP_019840974
UniProt: A0A6P5DSX0
LinkDB
Position
23
AA seq 239 aa
MAPAPXFRGHQWTYNLVRGSCLLLLLVMSNLLLCQGILCPSLCPDGDDVCRASLIDLFVH
ASVLSTGMYNHSVKMFTDFDEQYAQGKEYFINVSDKCHTNSLHLPEDMQHIRRMNSKGLI
MWILMLLYSWQRPLYQLVTDLRSMKEVSNTILSSARENVKKLKELQALIERPFSQVIFTA
RRKMYJARIYWFGLRSLLSSNEDRRHSAFYSLFFCLRRDTRKLDIYTKFVACRLIYKKC
NT seq 720 nt   +upstreamnt  +downstreamnt
atggctccagctcccarcttccgtggacaccagtggacttacaaccttgtccgagggtcc
tgcctgctcctgctgctggtcatgtcaaatctgctcttgtgccaaggcatcttatgcccg
tccctctgtcctgacggggatgacgtctgccgggcctcccttatagacctgtttgtccat
gcctccgttctgtccaccggcatgtataaccactccgtgaaaatgttcactgattttgat
gaacagtatgcccagggcaaagagtactttatcaatgtctccgacaagtgccacaccaat
tccctccatctccctgaagacatgcagcacatccgacggatgaacagtaaaggccttatt
atgtggatactcatgttactatactcctggcaaagacctctgtatcagctagtcacggac
ctgcggagtatgaaagaagtctcaaatactatcctatccagcgctagagaaaatgtgaaa
aaactaaaagaacttcaagcactcatagagaggccgttcagccaggttatttttacagcc
aggaggaagatgtacmtcgctcgcatttactggtttggactccgatccctactgtcgagc
aatgaagataggcgtcattctgcattttatagcctgttcttctgcctgcgcagagatact
cgtaaacttgacatttacaccaagttcgtggcgtgccgactgatctataagaagtgttaa

KEGG   Bos indicus (zebu cattle): 109576814
Entry
109576814         CDS       T04792                                 

Definition
(RefSeq) placental prolactin-related protein 3-like
  KO
K05439  prolactin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109576814
   04151 PI3K-Akt signaling pathway
    109576814
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109576814
   04060 Cytokine-cytokine receptor interaction
    109576814
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109576814
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109576814
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109576814
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 109576814
NCBI-ProteinID: XP_019840995
UniProt: A0A6P5DVC3
LinkDB
Position
23
AA seq 237 aa
MAPAPSFHGHQWTYNPVRGSCLLLLLVMSNLLLCQGNSCPSCCPDVSDIPLDLXRELFLN
ATLLSQSILKHSRIMLNEFDEKYAQGKLYYLTATKSCHTNSLHTTEDMDKAEKIDNEDLS
KWILMLLYSWHRPLNHLVTDMRGMIEVSDTILSNAKENVKKVEELQAFIERQFCQIIIPV
MRKMLENNIYWSGLPSLLSSDEDVRHSAFYSLFHCLHRDTLEIDIYTKILARRMINT
NT seq 714 nt   +upstreamnt  +downstreamnt
atggctccagctcccagcttccatggacaccagtggacttacaaccctgtccgagggtcc
tgcctgctgctgctgctggtcatgtcaaatctgctcctgtgccaaggcaactcatgcccr
tcctgctgtcctgacgtgtctgacatccccctggatttacwtagagaactgtttctcaat
gccaccttgctgtcccaaagcatccttaagcattccagaataatgttgaatgagtttgat
gaaaagtatgcccagggcaaactgtactatctcactgccaccaagagctgccataccaat
tccctccatactaccgaagacatggacaaagctgaaaagatagacaatgaagaccttagt
aagtggatactcatgttactgtactcctggcatagacctctgaatcatctagtcactgac
atgcggggtatgatcgaagtctcagacactatcctatcaaatgccaaagagaacgtgaaa
aaagtagaagaacttcaagcattcatagagaggcaattctgccagattattattccagta
atgcggaagatgttggagaataatatttactggtcgggactcccatccctgttgtccagc
gatgaagatgtgcgtcattctgcattttatagcctgttccactgcctgcacagggacaca
cttgaaattgacatttacaccaagatcctggcacgccgaatgatcaacacctag

KEGG   Bos indicus (zebu cattle): 109577296
Entry
109577296         CDS       T04792                                 

Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109577296
   04151 PI3K-Akt signaling pathway
    109577296
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109577296
   04060 Cytokine-cytokine receptor interaction
    109577296
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109577296
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109577296
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109577296
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 109577296
NCBI-ProteinID: XP_019841745
UniProt: A0A223LNC2
LinkDB
Position
23
AA seq 229 aa
MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIH
DLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRS
WNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVW
SGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
NT seq 690 nt   +upstreamnt  +downstreamnt
atggacagcaaaggttcgtcgcagaaagggtcccgcctgctcctgctgctggtggtgtca
aatctactcttgtgccagggtgtggtctccaccccygtctgtcccaatgggcctggcaac
tgccaggtatcccttcgagacctgtttgaccgggcagtcatggtgtcccactacatccat
gacctctcctcggaaatgttcaacgaatttgataaacggtatgcccagggcaaagggttc
attaccatggccctcaacagctgccatacctcctcccttcctacccctgaagataaagaa
caagcccaacagacccaccatgaagtccttatgagcttgattcttgggttgctgcgctcc
tggaatgaccctctgtatcacctagtcaccgaggtacggggtatgaaaggagccccagat
gctatcctatcgagggccatagagattgaggaagaaaacaaacgacttctggaaggcatg
gagatgatatttggccaggtaattcctggagccaaagagactgagccctaccctgtgtgg
tcaggactcccgtccctgcaaactaaggatgaagatgcacgttattcygctttttataac
ctgctccactgcctgcgcagggattcaagcaagattgacacttaccttaagctcctgaat
tgcagaatcatctacaacaacaactgctaa

KEGG   Bos indicus (zebu cattle): 109577452
Entry
109577452         CDS       T04792                                 

Definition
(RefSeq) placental prolactin-related protein 3-like
  KO
K05439  prolactin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109577452
   04151 PI3K-Akt signaling pathway
    109577452
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109577452
   04060 Cytokine-cytokine receptor interaction
    109577452
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109577452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109577452
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109577452
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 109577452
NCBI-ProteinID: XP_019841937
UniProt: A0A6P5DYE4
LinkDB
Position
23
AA seq 278 aa
MSSRFSLRSIPCSRFPPSHPIGLTPYGQQASSPWGHSTIPMAPAPSFHAHQWTYNPVRGS
CLLLLLVMSNLLLCQGNSCLCSRPAVIDIPLESLTXLLLNASRLSHNILKHSRTMFHEFD
IKYAQGKLYYINAIKSCHTNSLQTPEEPEKVLETNIKDLSKWILMLLYSWNRPLYHLVTD
LRSMKEVSDSIQSNARESVKNLLELQALIERQFCQIIFPVRRKMLKARIYWCGLPSLESS
DEDVRHSEFYKLFKCLYRDSRKVDMYTTILGCRLSNSC
NT seq 837 nt   +upstreamnt  +downstreamnt
atgtcctcaaggttttctttaagaagcattccwtgtagcagatttcctccatcccatccc
attgggctgactccctatggtcaacaggcgtcctcaccctggggtcattccacaatcccc
atggctccagctcccagcttccatgcacaccagtggacttacaaccctgtccgagggtcc
tgcctgctcctgctgctggtcatgtcaaatctgctactgtgccaaggcaactcatgcctg
tgctcccgtcctgccgtgattgacatccccctggaatccctaacartactgttactcaat
gcctccaggctgtcccacaacatccttaagcattccagaacaatgttccatgagtttgat
ataaaatatgcccagggcaaactgtactatatcaatgccatcaagagctgccacaccaat
tccctccaaactcccgaagaaccagaaaaagtcctagagacgaacattaaagaccttagt
aagtggatactcatgttactgtactcctggaatagacctctgtatcatctagtcacagac
ctgcggagtatgaaagaagtctcagattctattcaatcaaatgccagagagagtgtgaaa
aatctactagaacttcaagcactcatagagaggcaattctgccagattatttttccagta
aggcggaagatgttgaaggctcgcatttactggtgtggactcccatccctggagtccagc
gatgaagatgtgcgtcattctgaattttataagctgttcaagtgcctgtatagggattca
cgtaaagttgacatgtacaccacgatcctgggatgccgactcagcaactcgtgctaa

KEGG   Bos indicus (zebu cattle): 109577453
Entry
109577453         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: placental prolactin-related protein 3-like
  KO
K05439  prolactin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109577453
   04151 PI3K-Akt signaling pathway
    109577453
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109577453
   04060 Cytokine-cytokine receptor interaction
    109577453
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109577453
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109577453
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109577453
SSDB
Motif
Pfam: Hormone_1 DUF3135
Other DBs
NCBI-GeneID: 109577453
NCBI-ProteinID: XP_019841938
UniProt: A0A6P5DU96
LinkDB
Position
23
AA seq 238 aa
MAPAPSFRGHQWTYNPVRGSCLLLLMVMSNLLLCQGNSCPSCCPDVFDIPLESLTHLFLN
ASRLSHDIVNHTTIMFHEFDEKYAQNQPYTINATKSCHTNSLHTPQEREKALRMNNEDLS
KWILMLLYSWHRPLYLLVKDLQSMKEVSDTILSSAKENMRKIEELQAXIERQFSQVIYPV
IRTIFKARIYWSGLASLVSNDEDVRHSAFYKLFMCLYRDSRKLDMYTEILACRITNTC
NT seq 717 nt   +upstreamnt  +downstreamnt
atggctccagctcccagcttccgtggacaccagtggacttacaaccctgtccgaggttcc
tgcctgctcctgctgatggtcatgtcaaatctgctcctgtgccaaggcaactcatgcccg
tcctgctgtcctgacgtgtttgacatccccctggaatcccttacacacctgtttctcaat
gcctccaggctgtcacatgatatcgttaaccataccaccataatgttccatgagtttgat
gaaaaatatgcccagaaccaaccatacactatcaatgccacgaaaagctgccataccaat
tccctccatactccccaagaaagagaaaaagccctaaggatgaacaatgaagaccttagt
aagtggatactcatgttactgtactcctggcatagacctctgtatcttctagtcaaggac
ctgcagagtatgaaagaagtctcagatactatcctatcaagtgccaaagagaacatgaga
aaaatagaagaacttcaagcantcatagagaggcaattcagccaggttatttatccagta
atacggacaatattcaaggctcgcatttactggtcaggactcgcatccctggtgtccaac
gatgaagatgtgcgtcattctgcattttacaagctgttcatgtgcctgtatagggattca
cgtaaacttgacatgtacaccgagatcctggcgtgccgaatcaccaacacrtgctaa

KEGG   Bos indicus (zebu cattle): 109578290
Entry
109578290         CDS       T04792                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04066  HIF-1 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109578290 (EPO)
   04066 HIF-1 signaling pathway
    109578290 (EPO)
   04151 PI3K-Akt signaling pathway
    109578290 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109578290 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109578290 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109578290 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109578290 (EPO)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109578290 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 109578290
NCBI-ProteinID: XP_019842903
UniProt: A0A6P5DX81
LinkDB
Position
25
AA seq 192 aa
MGARDCTPLLMLSFLLFPLGFPVLGAPARLICDSRVLERYILEAREAENATMGCAEGCSF
NENITVPDTKVNFYAWKRMEVQQQALEVWQGLALLSEAILRGQALLANASQPCEALRLHV
DKAVSGLRSLTSLLRALGAQKEAISLPDATPSAAPLRAFTVDALSKLFRIYSNFLRGKLT
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggcgcgcgactgtactccgctgctgatgctgtcctttctgctgtttcctttgggc
ttcccagtcctgggcgcccccgcacgcctcatctgtgacagccgagtcctggagaggtac
atcctggaggccagggaggccgaaaatgccacgatgggctgtgcagaaggctgcagcttc
aatgagaatatcactgtgccagacaccaaggttaacttctatgcctggaagaggatggag
gtccagcagcaggctctggaagtctggcagggcctggccctgctctcagaagctatcctg
cggggccaggccctattggccaacgcgtcccagccatgcgaggccctgcggctgcacgtg
gacaaagctgtcagcggcctccgcagtctcacctccctgcttcgggcgctgggagcccag
aaagaagccatctcccttccagatgcaaccccctccgcagccccactccgagcattcact
gttgatgctttgtccaagcttttccgaatctactccaatttcctgcggggaaagctgact
ctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system