Bos indicus (zebu cattle): 109557512 Help Entry 109557512         CDS       T04792                                  Definition (RefSeq) cytochrome c   KO K08738   cytochrome c Organism biu  Bos indicus (zebu cattle) Pathway biu01524   Platinum drug resistance biu04115   p53 signaling pathway biu04210   Apoptosis biu04215   Apoptosis - multiple species biu04932   Non-alcoholic fatty liver disease biu05010   Alzheimer disease biu05012   Parkinson disease biu05014   Amyotrophic lateral sclerosis biu05016   Huntington disease biu05017   Spinocerebellar ataxia biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases biu05132   Salmonella infection biu05134   Legionellosis biu05145   Toxoplasmosis biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05200   Pathways in cancer biu05210   Colorectal cancer biu05222   Small cell lung cancer biu05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:biu00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109557512    04215 Apoptosis - multiple species     109557512    04115 p53 signaling pathway     109557512  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109557512   09162 Cancer: specific types    05210 Colorectal cancer     109557512    05222 Small cell lung cancer     109557512   09164 Neurodegenerative disease    05010 Alzheimer disease     109557512    05012 Parkinson disease     109557512    05014 Amyotrophic lateral sclerosis     109557512    05016 Huntington disease     109557512    05017 Spinocerebellar ataxia     109557512    05020 Prion disease     109557512    05022 Pathways of neurodegeneration - multiple diseases     109557512   09166 Cardiovascular disease    05416 Viral myocarditis     109557512   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     109557512   09171 Infectious disease: bacterial    05132 Salmonella infection     109557512    05134 Legionellosis     109557512    05152 Tuberculosis     109557512   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109557512    05161 Hepatitis B     109557512    05160 Hepatitis C     109557512    05164 Influenza A     109557512    05162 Measles     109557512    05168 Herpes simplex virus 1 infection     109557512    05163 Human cytomegalovirus infection     109557512    05167 Kaposi sarcoma-associated herpesvirus infection     109557512    05169 Epstein-Barr virus infection     109557512   09174 Infectious disease: parasitic    05145 Toxoplasmosis     109557512   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     109557512 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  109557512 NCBI-ProteinID:  XP_019814436 UniProt:  A0A6P5CLR8 LinkDB All DBs Position 4 AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctgtttggacgaaag acaggtcaggctcctggattctcttacacagatgccaataagaacaaaggtatcacctgg ggagaggagacgctgatggagtacttggagaatcccaagaagtacatccctggaacaaag atgatctttgctggcattaagaagaagggagagagggaagacttgatagcttatctcaaa aaagctaccaatgagtaa

Bos indicus (zebu cattle): 109566483 Help Entry 109566483         CDS       T04792                                  Definition (RefSeq) cytochrome c   KO K08738   cytochrome c Organism biu  Bos indicus (zebu cattle) Pathway biu01524   Platinum drug resistance biu04115   p53 signaling pathway biu04210   Apoptosis biu04215   Apoptosis - multiple species biu04932   Non-alcoholic fatty liver disease biu05010   Alzheimer disease biu05012   Parkinson disease biu05014   Amyotrophic lateral sclerosis biu05016   Huntington disease biu05017   Spinocerebellar ataxia biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases biu05132   Salmonella infection biu05134   Legionellosis biu05145   Toxoplasmosis biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05200   Pathways in cancer biu05210   Colorectal cancer biu05222   Small cell lung cancer biu05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:biu00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109566483    04215 Apoptosis - multiple species     109566483    04115 p53 signaling pathway     109566483  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109566483   09162 Cancer: specific types    05210 Colorectal cancer     109566483    05222 Small cell lung cancer     109566483   09164 Neurodegenerative disease    05010 Alzheimer disease     109566483    05012 Parkinson disease     109566483    05014 Amyotrophic lateral sclerosis     109566483    05016 Huntington disease     109566483    05017 Spinocerebellar ataxia     109566483    05020 Prion disease     109566483    05022 Pathways of neurodegeneration - multiple diseases     109566483   09166 Cardiovascular disease    05416 Viral myocarditis     109566483   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     109566483   09171 Infectious disease: bacterial    05132 Salmonella infection     109566483    05134 Legionellosis     109566483    05152 Tuberculosis     109566483   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109566483    05161 Hepatitis B     109566483    05160 Hepatitis C     109566483    05164 Influenza A     109566483    05162 Measles     109566483    05168 Herpes simplex virus 1 infection     109566483    05163 Human cytomegalovirus infection     109566483    05167 Kaposi sarcoma-associated herpesvirus infection     109566483    05169 Epstein-Barr virus infection     109566483   09174 Infectious disease: parasitic    05145 Toxoplasmosis     109566483   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     109566483 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  109566483 NCBI-ProteinID:  XP_019826447 UniProt:  A0A6P5CLR8 LinkDB All DBs Position 11 AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctgtttggacgaaag acaggtcaggctcctggattctcttacacagatgccaataagaacaaaggtatcacctgg ggagaggagacgctgatggagtacttggagaatcccaagaagtacatccctggaacaaag atgatctttgctggcattaagaagaagggagagagggaagacttgatagcttatctcaaa aaagctaccaatgagtaa

Bos indicus (zebu cattle): 109566484 Help Entry 109566484         CDS       T04792                                  Definition (RefSeq) cytochrome c   KO K08738   cytochrome c Organism biu  Bos indicus (zebu cattle) Pathway biu01524   Platinum drug resistance biu04115   p53 signaling pathway biu04210   Apoptosis biu04215   Apoptosis - multiple species biu04932   Non-alcoholic fatty liver disease biu05010   Alzheimer disease biu05012   Parkinson disease biu05014   Amyotrophic lateral sclerosis biu05016   Huntington disease biu05017   Spinocerebellar ataxia biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases biu05132   Salmonella infection biu05134   Legionellosis biu05145   Toxoplasmosis biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05200   Pathways in cancer biu05210   Colorectal cancer biu05222   Small cell lung cancer biu05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:biu00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109566484    04215 Apoptosis - multiple species     109566484    04115 p53 signaling pathway     109566484  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109566484   09162 Cancer: specific types    05210 Colorectal cancer     109566484    05222 Small cell lung cancer     109566484   09164 Neurodegenerative disease    05010 Alzheimer disease     109566484    05012 Parkinson disease     109566484    05014 Amyotrophic lateral sclerosis     109566484    05016 Huntington disease     109566484    05017 Spinocerebellar ataxia     109566484    05020 Prion disease     109566484    05022 Pathways of neurodegeneration - multiple diseases     109566484   09166 Cardiovascular disease    05416 Viral myocarditis     109566484   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     109566484   09171 Infectious disease: bacterial    05132 Salmonella infection     109566484    05134 Legionellosis     109566484    05152 Tuberculosis     109566484   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109566484    05161 Hepatitis B     109566484    05160 Hepatitis C     109566484    05164 Influenza A     109566484    05162 Measles     109566484    05168 Herpes simplex virus 1 infection     109566484    05163 Human cytomegalovirus infection     109566484    05167 Kaposi sarcoma-associated herpesvirus infection     109566484    05169 Epstein-Barr virus infection     109566484   09174 Infectious disease: parasitic    05145 Toxoplasmosis     109566484   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     109566484 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  109566484 NCBI-ProteinID:  XP_019826448 UniProt:  A0A6P5CLR8 LinkDB All DBs Position 11 AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctgtttggacgaaag acaggtcaggctcctggattctcttacacagatgccaataagaacaaaggtatcacctgg ggagaggagacgctgatggagtacttggagaatcccaagaagtacatccctggaacaaag atgatctttgctggcattaagaagaagggagagagggaagacttgatagcttatctcaaa aaagctaccaatgagtaa

DBGET integrated database retrieval system