KEGG   Bos indicus (zebu cattle): 109557558
Entry
109557558         CDS       T04792                                 

Gene name
GLI3
Definition
(RefSeq) transcriptional activator GLI3
  KO
K06230  zinc finger protein GLI3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04024  cAMP signaling pathway
biu04340  Hedgehog signaling pathway
biu05200  Pathways in cancer
biu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    109557558 (GLI3)
   04024 cAMP signaling pathway
    109557558 (GLI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109557558 (GLI3)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    109557558 (GLI3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109557558 (GLI3)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    109557558 (GLI3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 109557558
NCBI-ProteinID: XP_019814531
UniProt: A0A6P5BC64
LinkDB
Position
4
AA seq 1528 aa
MQPQIAPGLSKISEEPSTSSDEXASLIKKEIHGSLPHLAEPSVPYRGAVFAMDPRNGYME
PHYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHVPSALSSSPTYSDLPFIRISPH
RNPAAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISAARGLSPTDAPHAGVSPAEYYH
QMALLAGQRSPYADIIPSAATAGAGAIHMEYLHAMDSTRFPSPRLSARPSRKRTLSISPL
SDHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYPSAPVSLHM
HQQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTS
ESAVSSTGDLVHNKRSKIKPDEDLPSPGPRGQQEQPEGTTLVKEEGDKDESKQEPEVIYE
TNCHWEGCSREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRR
HTGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNR
THSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDVHPRPPPPRDSGGH
SQSRSPGRQTQGALGEQKDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSP
ISNYSNSGLELPLTDGGGVGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVK
LERLKQVNGMLPRLNPILPPKAPAVSPLIGNGTQPSTSCSLGGPMPLLPNRSDLSGVDIT
MLNMLNRRDSSTSTVSSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIS
TDASRRSSEASQGDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRMAL
LGDGREPAGTLPPVHPPRRCSDGGAHGYSRRPLLPQDALGNGVRRASDPVRTVSESLSLP
RVQRFNSLNSFNPPVLPPSLEKRNLVLQNYTRPDGGQARHFHSSPCPPSITENVTLESLT
MDADVSLNDEDLLPDDVVQYLNSQNPAGYEQHFPGTFSXDSKVPHGLGSGPGDFDPLGLP
DSHASHTGSQQYRSLEQPCPDASKSDLPIQWNEVSSGSADLSSSKLKCGQRSMGQQARAF
GSYSHMGVHPQNPLRSGAGPAGGYPTLGEHASSFGGPEHLVSHGGGAGTNGNAFHEPPYK
AQQYGNCLNRQPGAPTLLDGACGPGIQAAKLKSITMQGSGSHLDFGLSVVPNESTXSTVN
GIPTPDPTGQGYLAQQLLGDSTHTQGAGXSGQNLLGQASATSHIYQGPESSLPXPPSISV
QPPNVAAVRGYQPCVGYGGSRRQAGPRGGLALQPGQFSDPSQTCRVNGIKMEMPGQPHQL
CSNVQSYSGQFYDQTVGFGQQDMKTGSFSMSEANCLLQGAGAENSELLSPGANQVTSTVD
SLDSHDLEGVQIDFDAIIDDGDHASLMSGALSPSIIQNLSHSSSRLTTPRAALPFPPLSL
STTNMAIGDMSSLLTSLAEESKFLAVMQ
NT seq 4587 nt   +upstreamnt  +downstreamnt
atgcagccacagattgccccggggctcagcaagatcagcgaggagccttcaacatccagc
gacgagnnggcctcactgatcaagaaggagatccatgggtccttgccccacctggccgag
ccctctgtcccctaccgcggggctgtgtttgctatggaccccaggaatggctacatggag
cctcactatcaccctcctcatctctttcctgcattccatcctcctgtaccaattgatgcc
agacaccacgagggccgttaccattatgatccatctccgatccctccgttgcatgtgcct
tctgccttatctagtagccccacgtattctgacctgcccttcatcaggatctccccacat
cggaaccctgctgcagcttccgaatcccccttcagccccccgcatccctacatcaacccc
tacatggactacatccggtccctgcacagcagcccatccctctccatgatctcggccgct
cgtgggctgagccccacagatgccccccacgccggagtcagcccagcagaatactatcat
cagatggccctgttagccggccagcgcagcccctatgcagacatcattccctctgctgcc
accgcyggcgcaggggccatccacatggagtatcttcacgccatggatagcaccagattc
cccagccctaggctgtcagcccggccgagccgaaaacgtacactgtccatatcgccactg
tccgatcatagctttgaccttcagaccatgataaggacatctcccaactccttggtcacg
attctcaataattcccgcagcagctcttcagcaagtggctcctatggccacttatctgca
agtgcaatcagccctgccctgagcttcacctacccttcggcgccygtgtccctccacatg
catcagcagatcctaagccgacaacagagcttaggctcagcctttggacacagccctccg
ctcatccaccccgccccaactttcccgacccagaggcctattcccggaatccctacagtt
ctgaaccccgtccaggtcagctccggcccttccgagtcctcacagaacaagcccacgagt
gagtctgcagtgagcagtacgggggacctggtgcacaacaaacgctccaagatcaaacca
gatgaagacctccccagcccagggccacggggccagcaggaacagccagaaggaacaacc
ctggtgaaggaggaaggggacaaagatgaaagcaaacaggagcccgaagtcatctatgag
acaaactgccactgggaaggctgttctcgagagttcgacacccaggagcagctggtgcat
catataaataatgaccacatccatggagagaagaaggagtttgtgtgccggtggctcgac
tgctccagagaacagaaacccttcaaagcccagtatatgctggtggtgcacatgcgcagg
cacacgggggagaagcctcacaaatgcacttttgaaggttgcacaaaggcctactcgaga
ctcgaaaacttgaaaacacacttgagatctcacactggagagaaaccatacgtctgtgag
cacgaaggatgcaacaaggctttctctaatgcctcggatcgcgccaagcaccagaacagg
acacattccaacgagaaaccatatgtrtgcaaaatccccggctgcaccaagcgctacaca
gaccccagctccctccggaaacacgtgaagaccgtgcacggcccagaggctcatgtcacc
aagaagcagcgaggggacgtgcatccccggcccccgcccccgcgagattccggcggccac
tcacagtctaggtcacctggccggcagactcagggagccctcggggagcagaaggacctc
agcaacactacctcaaagcgggaagaatgcctccaagtgaaaacggtcaaggcggagaag
cccatgacatctcagccaagccctggtggtcagtcttcatgcagcagccaacagtccccc
atcagcaactattccaacagtgggctcgagcttcctctgaccgatggaggtggtgtgggc
gacctcagtgccatcgaygaaaccccaatcatggactcgaccatttccactgcaaccaca
gccctcgctttgcaagcccggaggaacccagcagggaccaaatggatggagcacgtcaaa
ctagaaaggctcaaacaagtgaatggaatgcttccacgactgaaccccattctaccccct
aaagcccctgcagtctctcctctcataggaaacggcacgcagcccagtaccagctgcagt
ctgggcgggcccatgcccctcctcccgaacagaagcgacctgtctggggtggacatcacc
atgttgaacatgctcaaccggagggacagcagcaccagcaccgtcagctcygcctacctg
agcagccgccgctcctctggcatctcgccctgcttctccagccgccggtccagcgaggcg
tcccaggccgaggggcgaccccagaacgtgagcgtggccgactcttacgaccccatctcc
accgacgcctctcgcaggtccagcgaggccagccagggcgacggtctgcccagcctgctc
agcctcactcccgcccagcagtaccgcctgaaagccaagtacgcygccgccacgggcggc
cccccgcccaccccgctgcccaacatggagaggatgagcctcaagacccggatggccctg
ttgggagatggcagggagccggcggggaccctgcctcccgtgcatcctcctcggagatgc
agcgacggcggggcccacggttacagccggcgcccactgctgccscaggatgcgctgggc
aacggcgtgagaagagccagcgacccggtgaggacggtttcggagagcctctctctgccc
cgggtacagcggttcaacagccttaacagcttcaaccctccggtgttgcctccatccctg
gaaaagcgcaacctcgtgcttcagaactacacgcggcccgatgggggccaggcccgccac
ttccactcctctccctgtcccccgagcatcactgagaatgtcaccctggagtccctgacc
atggacgccgacgtgagcctgaacgatgaggacctcctgcctgatgacgtggtgcagtat
ttaaattcccagaacccagccgggtatgagcagcacttcccaggcaccttctctkatgac
agcaaagtgccccayggcttagggagtggacccggggactttgacccactggggctgccc
gacagccacgccagccacaccggcagccagcagtaccgcagcctggagcagccctgcccc
gatgccagtaaatccgacctgcccattcagtggaacgaagtcagctccggcagcgcggac
ctgtcctcctccaagctgaaatgyggccagcggtccatggggcagcaggcccgggccttc
gggtcgtacagccacatgggtgttcacccacagaatccattgaggagtggggctggccca
gctggggggtatccgacccttggggagcatgccagctccttcgggggcccggaacactta
gtgagccacggtggcggagctggcaccaatgggaatgccttccatgaaccaccctataag
gcccagcagtatgggaactgcctcaacaggcagcctggtgcccccaccttactcgatggg
gcctgtggccctgggatccaggcggcaaagctgaaaagcatcaccatgcaagggagcggg
agccatctggattttggcctgtcggtggtgccgaatgagtcaaccrgcagcacggtgaat
ggcatacccaccccagaccccacaggacaggggtacctggctcagcagctcctcggtgac
agcacacacacccagggggcaggccrctccgggcagaacctgctggggcaggctagtgct
acctcacacatctatcaagggccggagagcagcctgcccrggcctcccagcatcagcgtg
cagccgccaaacgtggcagccgtcaggggctaccagccatgtgttggctacgggggcagc
cggcgccaggctgggccgaggggtggtctcgctctgcagccaggacagtttagtgacccg
agtcagacctgcagggtgaatggcatcaagatggagatgccaggacagccccatcagctc
tgttcgaatgtgcagagttactctggtcagttctatgaccaaacygttggcttcggtcag
caagacatgaaaactggttccttctccatgtcagaagccaactgcctgctccagggggcc
ggcgccgaaaactctgaattactctccccaggtgctaaccaggtgacaagcacagttgac
agcctcgacagccatgacctggaaggggtgcagattgatttcgacgctatcatagacgac
ggggaccacgccagcctgatgtcaggagccctgagcccaagcattattcagaacctttct
catagctcctcccgactcaccacgccgcgagccgcccttccgttcccgcctctgtctttg
agcaccaccaacatggcaatcggrgacatgagctctctgctgacctccctcgcggaagaa
agcaaattccttgcggttatgcagtaa

KEGG   Bos indicus (zebu cattle): 109559320
Entry
109559320         CDS       T04792                                 

Gene name
GLI1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04024  cAMP signaling pathway
biu04340  Hedgehog signaling pathway
biu05200  Pathways in cancer
biu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    109559320 (GLI1)
   04024 cAMP signaling pathway
    109559320 (GLI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559320 (GLI1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    109559320 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109559320 (GLI1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    109559320 (GLI1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Other DBs
NCBI-GeneID: 109559320
NCBI-ProteinID: XP_019816513
UniProt: A0A6P5BTG8
LinkDB
Position
5
AA seq 1105 aa
MFNSMTPPPVSSYGEPCCLRPLPSQGAPGMGTEGLPGLPFCHQATLMPGPHSYGPAREAN
SCTEVPLFPPPRSAVKLTKKRALSISPLSDTSLDLQTVIRTSPSSLVAFINSRCASPGGS
YGHLSIGTMSPSLGFSPQMNHQKGTSPSFGVQPCGPHDPTQSGMMPHPQSRGPLPTCQLK
SELGVLVNKCPEEPLEGDMSSPNSSSTQDPLLGMLDGREDLEREEKPEPDSVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPALSSVEPKRERDG
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSS
LDEGPCLAGTGLSTLRRLENLRLDQLHQFRPMGPRGLKLPSLTHTGTPGSRRLGAPVSLD
RRSSSSSSVSSAYTVSRRSSLASPFPPGSPPENGASSLPGLTPAQHYLLRARYASARGGG
TPPTAAPSLDRTGALPAPPWRSRAEYPGYNPNVGVTRRASDPARSVDRPAPARVQRFKSL
GCVHNTPTVVGGGQNFDPQLPTSVYSPQPPSITENVSMDTRGLREEPEVGTSMMGSGLNP
YMDFPPADTLGYGGPEAAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQVPYSEPTPETW
SEFPSHSGLYSGPKAPAGAYSQCPRLEHYGQVQVKPEQGCPVGSDATGLAPCLNAHPNEG
PPRSQPLFSHYPQPPPPQYPQSGSYTQPPPDYLPSEARPSLDFESPTHSTGHLKAQLVCN
YVQSQQELLWDSGGRGDPPVQEPLYQSPKFLGGSQVSPSPAKAPVATYGPGFAPNMPNHK
PGSYPTPSCHENFAVGANKASHRAAAPPRLLPPLPACYGPLKAGGTNPSCGHPEVGRLGG
GPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEAQGLSPPPSHNQRDSSEHTPPPSGTP
NMAVGNMSVLLGSLPGETQFLNSSA
NT seq 3318 nt   +upstreamnt  +downstreamnt
atgttcaactcgatgaccccaccaccagtcagtagctatggcgagccctgttgtctccgg
cccctccccagtcagggggcccccggcatggggacagaaggactgccaggtctgcccttc
tgtcatcaggccaccctcatgcccggcccccacagttatgggccagccagagaagccaac
agctgcacggaggtgccactgtttcctcctccccggagtgcagtcaaattgaccaagaag
cgggcactctccatctcacctctgtcggacaccagcctggacctgcagacagttatccgc
acctcacccagctccctcgtggccttcatcaactcacgctgtgcatctccggggggttcc
tatggtcacctctccatcggcaccatgagcccatctctgggattctcaccccagatgaac
caccagaaagggacctcaccttcttttggggtccagccctgtggtccccatgaccccacg
cagagtgggatgatgccgcatcctcagtcccggggacccctcccaacgtgccagctgaag
tctgagctgggtgtgctggttaacaagtgcccggaggagcccttggaaggtgatatgtcc
agtcccaactcctcgagcacacaggatccactgctggggatgctggatgggcgggaggac
ctagagagagaagagaaacctgagcctgactctgtgtatgagactgactgtcgctgggat
ggctgcagtcaggaattcgactcccaggagcaactggtgcatcacatcaacagtgagcac
atccatggagagcggaaggagttcgtgtgccattgggggggctgctccagggagctgagg
cccttcaaagcccagtacatgctggtggtgcacatgcgcagacacacgggcgagaagcca
cataagtgcacgtttgaggggtgccggaagtcatactcacgcctggaaaatctgaagacg
cacctgcggtcacacactggtgagaagccatacatgtgtgagcatgagggctgcagtaaa
gccttcagcaatgccagtgaccgagccaagcaccagaatcggacccattccaatgagaag
ccctacgtgtgtaaactccctggctgcaccaaacgctacacagatcccagctcgctcagg
aaacatgtcaagacagtacacggtcctgatgcccacgtgaccaagcggcatcgaggagac
ggccccctgccccgggcaccggctctttcctcagtggaacccaagagggagcgggacgga
ggccccattagggaggagagcagactgactgtgccggagggtgccatgaagccacagccg
agtcctggggcccagtcgtcctgcagcagtgaccactccccagcaggcagcgcggccaat
acagacagcggtgtggaaatgactggaaatgcagggggcagcacggaggacctgtccagc
ttggatgaggggccttgccttgcgggaaccgggctgtctactcttcgccgccttgagaac
ctcaggctggaccagctacatcagttccggccgatggggccccggggcctcaaactgccc
agcttgacccacactggcactcctggctctcgccgtctgggcgccccagtatctcttgac
cgccgcagcagcagctccagcagtgtcagttcagcctatactgtcagccgccgctcctcc
cttgcctcccctttcccccctggttccccaccagagaacggggcatcctctctgcctggc
ctcacgcctgcccagcactacctgctccgggccagatatgcttcagccaggggaggtggt
accccacccactgcagcacccagcctggatcggacgggggctcttcctgcacctccctgg
agaagccgagctgagtatccaggatacaaccccaatgtaggggtcacccggagagccagt
gacccagcccgatctgttgaccgccctgccccagccagagtccagaggttcaagagtttg
ggctgtgtccacaacacccccacagtggtaggaggaggacagaacttcgatccccaactc
ccaacctctgtctactcaccacagccccccagcatcactgagaatgtctccatggatacc
agagggctacgcgaggagccagaggttgggacctccatgatgggcagtggtctgaacccc
tatatggacttcccacctgctgatactctgggatatggagggcctgaggcggcagcagct
gagccttatggagctagagggcccggctccctgcctcttgggcctggtccacccaccaac
tatggccccaacccctgtccccagcaggttccctattctgaaccaaccccagaaacatgg
agtgagttcccttcccactctgggctctactcaggccccaaggctccagctggagcctac
agccagtgtcctcgtcttgaacattatggacaagtgcaagtgaagccagaacaggggtgc
cccgtgggttctgacgccacaggactggcaccctgcctcaatgcccaccccaatgagggg
cctccccgctcacagcctctgttctcccactacccacagcctccccctccccagtatccc
cagtcaggttcctacacccagccacctcctgattatctgccttcagaagccaggcccagc
ctggatttcgagtcccccactcattctacaggacacctcaaggcgcagcttgtgtgtaat
tatgttcagtctcaacaggagctgctgtgggacagtggaggcaggggagaccctccagtc
caagaacctctctatcagagtcccaagtttctggggggttcccaggtcagcccaagccct
gccaaggccccagtggccacatatggacctggctttgcacctaatatgcccaatcacaag
ccaggctcctatcctaccccttcatgccatgaaaattttgcagtaggggccaacaaagct
tcccatagggcagcagcaccaccccgacttctacccccactaccggcttgctatgggccc
ctcaaggcagggggcaccaaccccagctgtggccatcctgaggtgggcaggctgggaggg
ggccccgccttgtaccctcctcctgaagggcaggtgtgtaaccctctggactctcttgat
ctcgacaacacgcagctggactttgtggctattctggatgaggcccaggggctgagtcct
cccccttctcacaatcagagggacagctctgaacacaccccacctccctctgggacccct
aacatggccgtgggcaacatgagtgtgttactaggatctctgcctggggagacacagttc
ctcaattctagtgcttaa

KEGG   Bos indicus (zebu cattle): 109568632
Entry
109568632         CDS       T04792                                 

Gene name
GLI2
Definition
(RefSeq) zinc finger protein GLI2
  KO
K16798  zinc finger protein GLI2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04340  Hedgehog signaling pathway
biu04390  Hippo signaling pathway
biu05200  Pathways in cancer
biu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    109568632 (GLI2)
   04390 Hippo signaling pathway
    109568632 (GLI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109568632 (GLI2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    109568632 (GLI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109568632 (GLI2)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    109568632 (GLI2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 109568632
NCBI-ProteinID: XP_019829607
UniProt: A0A6P5CXN0
LinkDB
Position
2
AA seq 1557 aa
METSASATATDKKEVKGGILEGLAFPDPGRKASALAVATAAAAAAVAAQGVPPHLLPPFH
APFPIDMRHQEGRYHYEPHSVPGVHGPPALSGSPVISDISLIRLSPHPAGPGESPFNAPH
PYVSPHMDHYLREKHGSPTHPAISAARGLSPADVAHEHLKERGLFGLPAAGTNASDYYHQ
MTLMAGHPAPYGDLLMQTGGAASAPHLHDYLNPVDVSRFSSPRVTPRLSRKRALSISPLS
DASLDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQI
LSQQRGLGSAFGHTPPLIQPSPTFLAQQPVAFTSINATPTQLSSSSNCLSDANQNKQSSE
SAVSSTVNPIIIHKRSKVKTEADGLRPASPLTLTQEQLADLKEDLERDDCKQEAEVVIYE
TNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRR
HTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNR
THSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRAPLLRENGDS
EAGAEPGRGSEDNAEASSTSQAVEDGLHVKAIKTERSGLCQSSPGAQSSCSSEPSPLGSA
PNNDSGVEMPGTGPGSLADLTALEDPPPGADTSALAAPSAGGLQLRKHMTAMHRFEQLKK
EKLKSLKDSCSWAGPAPHTRTSKLPPLPGSGSVLENFSGGGGGGPAGLLPNPRLSELFPG
EVTVLSHLQERRDSSTSTVSSAYTVSRRSSGISPYFSSRRSSEXXXXGAGRAHPASSADS
YDPISTDASRRSSEASQCGGGPGLLQLTPAQQYSLRAKYAAATGGPPPTPLPGLERTSLR
TRLALLDAPERALPAACLRPIGPRRGSDGPHYGPSGPLPAFPHEXXXXXARRASDPGRRP
DALAAPRVQRFHSALDVTPGTLPPPCGQGRGLRLQSHTSADGSLARSGYSPRPPSISENV
VMEALAAGADGTGPEVSLGLPEDDLVLPDDVVQYIKARTSGTLEESTPPVYPPESTCFSE
NPKLPSPGLHGQRTIAAADSNVGPSAPVLGGCPLGYGAPSSLNKNSMPVQWNEVSSGTVD
ALASQVKPLPFPQGNLAVVPQKPAFAQYPGYNPQGLQPSPGGLDNSQPHLQPYSGAPSAP
RGNYTQQLRQPGAGSQCPNMTAAVNPHPGYGQAHPQLSTMGGTLNQFPSSCSNMATKPGH
LGLPQQMEVAPDPTMMGNSHRELGMPNSSLAGMPPPHPAQNYPQQSHHLVTTMSQEGYHQ
GPNLVPSHQPSFMEPQQGTMGAAGSSFGLMQPRPPPEPGPAGRHRGVRAGQQLAYARATG
HAMAAMSANQEMTESVPKGTMGSMLSLPPQPPPQDTGGTQDHSMLYYYGQIHMYEQNGGP
ENQAGCQALRPQPTQPQALPSPGVNQVSSTVDSQLLEAPQIDFDAIMDDSDHSSLLSGAL
SPSLLHGLSQSSSRLTTPRSSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMMT
NT seq 4674 nt   +upstreamnt  +downstreamnt
atggagacatccgcctcagccacggccacggacaagaaagaagtcaaaggtgggatcctg
gagggccttgctttccctgaccccggcaggaaagcctcggccctcgcggtggccacggcg
gcggctgcggccgcagtagctgcccaaggagtgccgccgcatctcctgccaccgttccac
gcccccttcccgattgacatgcgacaccaggagggacggtaccattacgagcctcactct
gtccccggcgtgcacgggcctcccgccctgagcggcagccctgtcatctctgatatctca
ttgattcggctttccccacacccygccggccctggggagtcccccttcaacgccccccac
ccgtacgtgagcccccacatggaccattacctgcgggaaaagcacggcagcccaacacat
cccgccatctctgcagccaggggcctcagccccgcggatgtggctcacgagcaccttaag
gagcgggggctctttggccttcccgctgcaggcaccaacgcctcagactattaccaccag
atgactctcatggcaggtcaccccgcgccatatggggacctgctgatgcagactgggggt
gcggccagtgcaccccatctccatgactacctcaatccagtggatgtgtcacgtttctcc
agcccccgggtgacaccccgcctgagccgcaagcgggcgctgtccatctccccgctctca
gacgccagcctcgacctccagcgcatgatccggacctcgcccaactcgctggtggcctac
atcaacaactcccgcagcagctcggctgccagcggctcctacggacacctgtcggccggt
gccctcagcccagccttcaccttcccccaccccatcaaccccgtggcctaccagcagatc
ctgagccagcagaggggcctgggctcagccttcggacacacgccacccctgatccagccc
tcgcccaccttcctggcccagcagccagtggccttcacctccatcaatgccacacccacc
cagctcagtagcagcagcaactgtctgagtgacgccaatcagaacaagcagagcagcgag
tcagccgtgagcagcactgtcaaccccatcatcattcacaagcgcagcaaggtcaaaact
gaggctgacggcctacggccagcctccccactgaccctaacacaggagcagctggctgac
ctcaaggaggacctggagagagacgattgtaagcaggaggctgaggtggtcatctatgag
accaactgccactgggaggactgcaccaaggagtacgacacgcaggagcagctggtgcac
cacatcaacaacgagcacatccacggggagaagaaggagtttgtgtgccgctggcaggcc
tgcacgcgtgagcagaagcccttcaaggcacagtacatgcttgtggtgcacatgcgcaga
cacacaggcgagaagccccacaagtgcacgttcgagggctgctcaaaggcctattcccgc
ctggagaacctgaagactcacctgcgctcccacaccggggaaaagccgtatgtgtgtgag
cacgagggctgcaacaaagccttctccaatgcctcagaccgcgccaagcaccagaaccgc
acccactccaacgagaaaccctacatctgcaagattccaggctgcaccaagcggtacacg
gaccccagctccctccggaagcacgtgaagacggtccatggcccagacgctcacgtcacc
aagaagcagcgcaacgatgtgcacctccgcgccccyctgctccgggagaatggggacagc
gaggccggtgccgagcccggccggggctccgaggacaacgccgaggccagcagcactagc
caggccgtggaggacggcctgcacgtcaaggccatcaagacggagcgctccgggctgtgt
cagtccagccccggagcccagtcttcctgcagcagcgagccctctcccctgggcagtgcc
cccaacaatgacagtggcgtggagatgccggggacagggcccgggagcctggcagacctg
acagctctggaggacccgccgccaggggctgacacctccgccctggccgccccctctgct
ggtggcctacagctgcgcaaacacatgaccgctatgcaccggttcgagcagctcaagaag
gagaaactcaagtcactgaaggattcctgctcatgggccgggccagctccgcacacccgg
acctccaagctgcctcccctcccgggaagtggctccgtgctggaaaacttcagcggcggc
gggggcggcggacccgcggggctgctgcccaacccgcggctrtctgagctgttcccgggc
gaggtgacagtgctgagccacctgcaggaacgccgggacagctccaccagcacagtcagc
tcggcctacaccgtgagccgccgctcctccggcatctccccctacttctctagtcgccgc
tccagcgaggnnnnnnnnntgggcgccggccgcgcgcaccctgccagctctgctgattcc
tacgaccccatctccaccgacgcatcacggcgctcgagtgaggccagtcagtgcggcggc
ggcccggggcttctccagctcacacccgcccagcagtacagcctacgggccaagtacgca
gcagccacaggtggacctcccccgaccccgctgccgggcctggagcgcacgagcctgcgg
acccggctggcgctgctggatgctcccgagcgcgcgctgcccgctgcctgcctgcgcccg
atcgggcctcggcggggcagcgacgggccacactacgggccctcggggccgttgcccgct
ttcccccacgaggnnnnnnnnnnnngggcgcggcgggccagcgatcctgggaggcggcct
gatgccctggcagccccgcgggtgcagcgcttccacagcgccctcgacgtgaccccaggc
acgctaccgccaccctgcggccagggccgaggcctccgtctgcaaagccacacgagcgca
gacggcagcctggcccgcagcggctactcgccccggccgcccagcatcagcgagaacgtg
gtgatggaagccttggcggcgggggcggacggcacaggcccagaggtcagcctcggactg
ccagaggacgacctcgtgctccccgatgacgtggtgcagtacatcaaggcacgtaccagt
ggcaccctggaggagagtaccccaccggtgtaccccccggaaagcacctgcttctctgag
aaccccaaactgcccagccccgggctgcacggccaacgtaccatagcagctgcagactca
aacgtgggcccctccgccccggtgctgggaggctgcccactgggctacggggccccctcc
agcctgaacaagaacagcatgcctgtgcagtggaacgaagtgagctcaggcaccgtggac
gcactggccagccaggtgaagcctctgcccttcccacagggcaacctagctgtggtacca
cagaaaccagccttcgcccagtacccaggatacaatccgcagggcctgcagccgagccct
gggggcctagacaactcacagccacacttacagccctacagtggagccccatccgcaccc
aggggaaattatacacagcagctgcggcagccaggggctggcagccagtgtcccaacatg
actgctgcagtgaacccccaccccggctatggccaagcccacccccagctgagcaccatg
ggtgggaccctgaaccarttcccctcctcttgcagcaacatggcaaccaagccaggccac
ctggggctcccccagcaaatggaagttgctcctgaccccaccatgatgggcaacagccac
agggagctcggcatgcccaattccagcctggccgggatgccaccacctcatccagcacag
aactacccacagcagagtcatcacctggtgaccaccatgagccaggagggctaccaccaa
ggccccaacctggtaccttcccaccaacctagtttcatggagccccagcagggcacaatg
ggggcagctggatctagctttggcctaatgcaaccccggccacccccagagcctggccct
gccggccgccaccgtggggtacgtgcagggcagcagctagcctatgccagggcaactggc
catgccatggctgctatgtcagccaaccaggagatgacagagtctgtacccaaggggaca
atgggcagcatgttgtccctaccccctcagccacccccacaggacacaggtgggacccag
gaccacagcatgctctactactatggccagatccacatgtacgagcagaacggaggccct
gagaaccaggccggctgccaagccctgcgaccscagccaacacagccccaggccttgccc
tcgccgggggtcaaccaggtgtccagcactgtggactcccagctacttgaggcaccccag
attgattttgatgccatcatggatgacagtgatcactccagcttgctttctggcgccctg
agccccagcctcctccacggcctctcccagagctcctcccgcctcaccaccccacgcagc
tccctgactctgccctccatccccgccggtatcagcaacatggccgtgggggacatgagc
tccatgctcaccagcctggccgaggagagcaagttcttgaacatgatgacctaa

DBGET integrated database retrieval system