KEGG   Bos indicus (zebu cattle): 109557596
Entry
109557596         CDS       T04792                                 

Gene name
LEP
Definition
(RefSeq) leptin isoform X1
  KO
K05424  leptin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04152  AMPK signaling pathway
biu04630  JAK-STAT signaling pathway
biu04920  Adipocytokine signaling pathway
biu04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109557596 (LEP)
   04152 AMPK signaling pathway
    109557596 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109557596 (LEP)
   04060 Cytokine-cytokine receptor interaction
    109557596 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109557596 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109557596 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109557596 (LEP)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109557596 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 109557596
NCBI-ProteinID: XP_019814592
UniProt: A0A6P5BKJ7
LinkDB
Position
4
AA seq 192 aa
MEPRRDRGIAAPAAARPQKPIPGRKMRCGPLYRFLWLWPYLSYVEAVPIRKVQDDTKTLI
KTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILTSLPSRNVV
QISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQ
DMLRQLDLSPGC
NT seq 579 nt   +upstreamnt  +downstreamnt
atggagccccggagggatcgaggaatcgcggcgccagcagcggcgaggccccagaagccc
atcccgggaaggaaaatgcgctgtggacccctgtatcgattcctgtggctttggccctat
ctgtcttacgtggaggctgtgcccatccgcaaggtccaggatgacaccaaaaccctcatc
aagacaattgtcaccaggatcaatgacatctcacacacgcagtccgtctcctccaaacag
agggtcactggtttggacttcatccctgggctccaccctctcctgagtttgtccaagatg
gaccagacattggcgatctaccaacagatcctcaccagtctgccttccagaaatgtggtc
caaatatccaatgacctggagaacctccgggaccttctccacctgctggccgcctccaag
agctgccccttgccgcaggtcagggccctggagagcttggagagcttgggcgtcgtcctg
gaagcytccctctactccaccgaggtggtggccctgagccggctgcaggggtcactacag
gacatgttgcggcagctggacctcagtcctgggtgctga

DBGET integrated database retrieval system