KEGG   Bos indicus (zebu cattle): 109557614
Entry
109557614         CDS       T04792                                 

Gene name
SMO
Definition
(RefSeq) smoothened homolog isoform X1
  KO
K06226  smoothened
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04340  Hedgehog signaling pathway
biu04360  Axon guidance
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    109557614 (SMO)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    109557614 (SMO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109557614 (SMO)
   05205 Proteoglycans in cancer
    109557614 (SMO)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    109557614 (SMO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109557614 (SMO)
G protein-coupled receptors [BR:biu04030]
 Frizzled / Smoothened family
  109557614 (SMO)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 109557614
NCBI-ProteinID: XP_019814621
UniProt: A0A6P5BCC1
LinkDB
Position
4
AA seq 780 aa
MAAARLARGPELLLLGLLLLLGGPGRGAALSGNATRPGPWSAGGSARRSAAVTGPPPLLS
HCGRAAPCEPLRYNVCLGSALPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVI
QPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDHFPEGCPNEV
QNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTG
LCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMR
LGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHL
LTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRG
VMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWER
SFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGISMSTWVWTKATL
LIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSMHTVSHDGPVAG
LAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEKANLWLVEAEIS
PELEKRLGRKKKRRKRKKEVCPLVPPPELHLPALGPASASSAVPRLPQLPRQKCLVAAGA
WGPGESCRPGAWTLVSNPFCPEPSAPAPVXWAQGRRQGLGPIHSRTNLMEAELMDADSDF
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggccgctgcccgccttgcacgggggccggagctcctgctcctggggctgctgctgctg
ctagggggcccgggccggggggcggccttgagtgggaacgcgacccggccggggccctgg
agcgcgggcgggagcgcgagaaggagcgcagccgtaaccggccctccgccgctgctgagc
cactgcggccgggccgccccctgcgagccgctgcgctacaacgtgtgcctcggctcggcg
ctgccytacggggccacctccacgctgctggccggggactcagactcccaggaggaggcg
cacggcaagctcgtgctctggtcgggcctccggaatgccccccgctgctgggcagtgatc
cagcccctactgtgtgctgtgtacatgcctaagtgtgagaacgaccgggtggagctgccc
agccgcaccctctgccaggccacccgcggcccctgtgccatcgtggagagggagcggggc
tggcctgacttcctgcgctgcacccccgaccacttccccgagggctgcccgaatgaggtg
cagaacatcaagttcaacagttccggccaatgcgaggctcccttggttcggaccgacaac
cccaagagctggtatgaggatgtggagggctgtgggatccagtgtcagaacccgctcttc
accgaggccgagcaccaggacatgcacagctacatcgcggccttcggggctgtcacgggc
ctctgcacactcttcaccctggccacatttgtggctgactggcggaactccaatcgctac
cctgccgtcattctcttctatgtcaatgcatgtttcttcgtgggcagcattggctggctg
gcccagttcatggatggggcccgccgggagatcgtctgccgtgctgatggcaccatgagg
ctcggggagcccacctccaatgagaccctgtcctgcgtcatcatctttgtcatcgtgtac
tacgccctgatggccggcgttgtctggtttgtggtcctcacctacgcctggcacacctcc
ttcaaagccctggggaccacctaccagcctctctccggcaagacttcttacttccacctg
ctcacgtggtcactcccctttgtcctcactgtggcaatcctcgccgtggcccaggtggac
ggggactctgtgagcggcatctgttttgtgggctataagaactaccgataccgcgctggc
ttcgtgctggcccccattggcctggtgctcattgtgggaggttacttcctcatccgagga
gtcatgaccctgttctccatcaagagcaaccaccctgggctgctgagcgaaaaggcagcc
agcaagatcaacgagaccatgctgcgtctgggcatttttggcttcctggcctttggcttt
gtgctcatcaccttcagctgccacttctatgacttcttcaaccaggctgagtgggagcgc
agcttccgggactatgtgttatgccaggccaatgtgaccatcgggctgcccaccaagaag
cccatccctgactgtgagatcaagaatcgscccagcctcctggtggagaagatcaaccta
tttgccatgtttggaactggcatttccatgagcacctgggtctggaccaaggccacactg
ctcatctggaggcgcacctggtgcaggttgacggggcagagtgatgatgaacccaaacgg
atcaagaagagcaagatgatcgccaaggccttctccaagcggcgggagctactgcagaac
ccaggccaggagctctccttcagcatgcacaccgtctcccacgacgggcctgtggcgggc
ttggcctttgacctcaatgagccctcagccgacgtgtcctctgcttgggcccagcacgtc
accaagatggtggcccggagaggtgccatactgccccaggatgtgtctgtcaccccggtg
gcaacgccagtgcccccrgaggaaaaagccaacctgtggctggttgaggcagagatctcc
ccggagctggagaagcgcctgggccggaagaagaagcggaggaagaggaagaaggaggtg
tgcccactggtgccacccccggagcttcacctccccgccctgggccctgcctccgcctct
agtgcggtccctcggctgccacagctgccccgacagaagtgcctggtggccgcgggcgcc
tggggacctggggagtcctgccgacctggagcctggactctggtctccaaccccttctgc
ccagagcccagcgccccagcccctgtgnnntgggcgcagggccgccggcagggactgggg
cccattcactcccgcaccaacctgatggaggcggaactcatggatgcagactccgacttc
tga

DBGET integrated database retrieval system