KEGG   Bos indicus (zebu cattle): 109557706Help
Entry
109557706         CDS       T04792                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00052  Galactose metabolism
biu00500  Starch and sucrose metabolism
biu01100  Metabolic pathways
biu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109557706
   00500 Starch and sucrose metabolism
    109557706
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109557706
Enzymes [BR:biu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     109557706
    3.2.1.20  alpha-glucosidase
     109557706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 DUF5110
Motif
Other DBs
NCBI-GeneID: 109557706
NCBI-ProteinID: XP_019814764
LinkDB All DBs
Position
4
AA seq 674 aa AA seqDB search
MVPYWSLGFQLCRYGYQNDSEIASLYDAMVAAQIPYDVQYSDIDYMERQLDFTLDAEFEG
FPALITRMRADGMRVIIILDPAISGNETKPYLPFTRGVEDDVFIKDPSDGSIVWGKVWPD
FPDVVINSSLDWDSQVEKYRAFVAFPDFFRNSTTTWWKRELRELYTNPREPEKSLKFDGL
WIDMNEPASFVNGAVPPGCKDATLNHPPYMPYLESRDRGLSSKTLCMESQQVLPDGSPVR
HYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNTAAWDQLKKS
IIGMMEFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPFARNHNTIGTKRQDPVSW
NSTFVTISKSVLETRYTLLPYIYTLMHKASTEGSTVVRPLLHEFVSDRVTWDVDSQFLLG
XAFLVSPVLEANARDVTAYFPRARWYDYYTGVDIQSRGEWKSLPAPLDHINLHVRGGYVL
PWQEPAQNTHLSRQKFLGFKVALDDEGAAEGWLFWDDGQSIDTYEKGLYYLAHFSVSQNM
MHSHIIFNNYISNTNPLRLGYFEVWGVGSDSISSVSISASGVVITPTFSYNSTTQVCDQF
KVQMVFPNPELWSAIPACSHSQQHPLLQSLSGIPLCSGCLGGQHRNEGKVQSLSPSGIDG
LDPYLSCMSSCLQT
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggttccttactggtccctggggtttcagctgtgtcgctatggataccagaacgactct
gagatcgccagcttgtacgatgctatggtggctgcacagatcccctatgatgtgcagtat
tcggacattgactacatggagcggcagctggacttcacccttgatgccgagtttgagggg
tttccagctctgattactcgcatgagggccgatgggatgcgagtcattatcattctggac
ccagccatttctggcaacgagaccaagccctatctgccattcacacggggtgtagaggat
gatgtcttcatcaaagatccgagtgatgggagcattgtctggggaaaggtctggcctgat
tttcctgatgtggtaataaacagttctctagactgggacagtcaagtggagaaataccgg
gcatttgtggcctttccagactttttccgtaattcaaccaccacatggtggaagagggag
ttgagagaactgtacaccaatccacgggaaccagagaagagcttgaagttcgatggcttg
tggattgatatgaatgaaccagcgagcttcgtgaatggagcagtccctccaggctgcaag
gatgccactctgaaccaccctccctatatgccatatctggagtccagggaccggggcctg
agcagcaagaccctgtgcatggagagccagcaggtcctgcctgacggctcaccggtgcgc
cactacgacgtgcacagcctctacgggtgggcccagaccagacccacatacgaagctgtg
caggaggtgacgggacagcgagggatcgtcatcactcgctccactttcccctcttctggc
cgctggggaggacactggctgggtgacaacacggctgcatgggaccagctgaagaagtca
atcattggcatgatggagtttagtctctttggtatatcctacacaggagcagatatttgt
ggattctttcaagatgctgaatatgaaatgtgtgctcgctggatgcaactaggggccttc
taccccttcgcaaggaatcacaataccattgggaccaagaggcaagaccccgtgtcctgg
aattctactttcgtgacaatctccaagagtgtcctggagaccagatacaccctgttgccg
tatatctacaccctgatgcacaaggccagcacagagggcagcaccgtcgtgcggcctctc
ctccatgagtttgtgtcagaccgggtgacctgggatgtagacagtcagttcctgctgggc
ycagccttcctggtcagccctgtcctggaggctaaygccagagatgtcactgcatatttc
cctagagcccgctggtatgattactacacgggtgtggacattcaatcccggggtgagtgg
aagtccttgccggcacctcttgaccacattaatcttcatgtccgtgggggctatgtcctg
ccctggcaagagcctgcacagaacacccacttaagccgtcagaaattcttaggtttcaag
gttgccttggatgatgagggggctgctgaaggctggctcttctgggatgatgggcaaagc
attgatacctatgaaaaaggactctattacctggcccacttttccgtcagccagaatatg
atgcacagtcatataattttcaacaactacatcagcaatacaaaccctttgagactgggc
tactttgaggtctggggagtgggcagtgactccatttccagtgtcagcatctctgcaagt
ggcgtggttataacacccaccttctcctacaactctacaacacaggtttgtgaccagttc
aaagtccaaatggtatttcccaaccctgagctatggagtgcaattcctgcctgctcccat
tcccaacaacaccctctcctgcaaagcctttctggaatccctctgtgttcagggtgtctg
ggtggacaacatagaaatgaagggaaagttcagagtttgtcaccatctggaattgatggt
ctggatccttatctgtcatgtatgtcctcctgtctgcaaacttaa

DBGET integrated database retrieval system