KEGG   Bos indicus (zebu cattle): 109557710Help
Entry
109557710         CDS       T04792                                 

Definition
(RefSeq) cationic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04080  Neuroactive ligand-receptor interaction
biu04972  Pancreatic secretion
biu04974  Protein digestion and absorption
biu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:biu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109557710
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    109557710
   04974 Protein digestion and absorption
    109557710
 Human Diseases
  Infectious diseases
   05164 Influenza A
    109557710
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     109557710
Peptidases [BR:biu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109557710
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109557710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 109557710
NCBI-ProteinID: XP_019814767
LinkDB All DBs
Position
4
AA seq 246 aa AA seqDB search
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLXCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcatctttctagctctcctgggagctgctgttgctttccctgtggacgat
gatgacaagatcgtgggcggctacacctgtggggcaaatactgtcccctaccaagtgtcc
ctgaactctggctaccacttctgcgggggctccctcatcaacagccagtgggtggtgtct
gcggctcactgctacaagtccggaatccaagtgcgtctgggagaagacaacattaatgtc
gttgagggcaatgagcaattcatcagcgcatccaagagcatcgtccatcccagctacaac
tcaaacaccttaaacaacgacatcatgctgattaaactgaaatcagctgccagtctcaac
agccgagtagcctctatctctctgccaacatcctgtgcctctgctggcacccagtgtctc
atctctggctggggcaacaccaaaagcagtggcaccagctaccctgatgtcctgmagtgt
ctgaaggctcccatcctatcagacagctcttgcaaaagtgcctacccaggccagatcacc
agcaacatgttctgtgcgggctacctggagggcggaaaggactcctgccagggtgactcc
ggtggccctgtggtctgcagtggaaagctccagggcattgtctcctggggctctggctgc
gctcagaaaaacaagcctggtgtctacaccaaggtctgcaactacgtgagctggattaag
cagaccatcgcctccaactaa

DBGET integrated database retrieval system