KEGG   Bos indicus (zebu cattle): 109557793
Entry
109557793         CDS       T04792                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00220  Arginine biosynthesis
biu00330  Arginine and proline metabolism
biu01100  Metabolic pathways
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04066  HIF-1 signaling pathway
biu04071  Sphingolipid signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04370  VEGF signaling pathway
biu04371  Apelin signaling pathway
biu04611  Platelet activation
biu04915  Estrogen signaling pathway
biu04921  Oxytocin signaling pathway
biu04926  Relaxin signaling pathway
biu04931  Insulin resistance
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    109557793 (NOS3)
   00330 Arginine and proline metabolism
    109557793 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109557793 (NOS3)
   04371 Apelin signaling pathway
    109557793 (NOS3)
   04066 HIF-1 signaling pathway
    109557793 (NOS3)
   04020 Calcium signaling pathway
    109557793 (NOS3)
   04071 Sphingolipid signaling pathway
    109557793 (NOS3)
   04022 cGMP-PKG signaling pathway
    109557793 (NOS3)
   04151 PI3K-Akt signaling pathway
    109557793 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109557793 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    109557793 (NOS3)
   04921 Oxytocin signaling pathway
    109557793 (NOS3)
   04926 Relaxin signaling pathway
    109557793 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109557793 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109557793 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109557793 (NOS3)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     109557793 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 109557793
NCBI-ProteinID: XP_019814885
UniProt: A0A6P5BRE3
LinkDB
Position
4
AA seq 1205 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPAPEPSRAPAPATPHAPDHSPAPNSPT
LTRPPEGPKFPRVKNWELGSITYDTLCAQSQQDGPCTPRRCLGSLVLPRKLQTRPSPGPP
PAEQLLSQARDFINQYYSSIKRSGSQAHEERLQEVEAEVASTGTYHLRESELVFGAKQAW
RNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRAPGR
GDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDE
APELFVLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFSAAPFSGWYM
STEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSFQLAKVTIV
DHHAATVSFMKHLDNEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPAFRYQPD
PWKGSATKGAGITRKKTFKEVANAVKISASLMGTLMAKRVKATILYASETGRAQSYAQQL
GRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYN
SSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYP
HFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAKAAFQASCETFCVGEEAKA
AAQDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATVLSVENLQSSKSTRAT
ILVRLDTAGQEGLQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPTESVAVEQLEKGSPG
GPPPSWVRDPRLPPCTLRQALTFFLDITSPPSPRLLRLLSTLAEEPSEQQELETLSQDPR
RYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPNAHPGEVHLTVA
VLAYRTQDGLGPLHYGVCSTWLSQLKTGDPVPCFIRGAPSFRLPPDPYVPCILVGPGTGI
APFRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQERGVFGRVLTAFS
REPDSPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDME
LDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWAFDPPGP
DTPGP
NT seq 3618 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggagcccgggcccccctgcggcctggggctgggg
ctgggcctcgggctatgcggcaagcagggcccagcctccccggcacctgagcccagccgg
gcccccgcacccgccaccccgcacgcgccagaccacagcccagctcccaacagccccacg
ctgacccggcctccggaggggcccaagttccctcgcgtgaagaactgggagctggggagc
atcacctacgacactctgtgcgcgcagtcccaacaggacgggccctgcactcccaggcgc
tgcctgggctccctggtgttgccccggaaactgcagacccggccctccccgggacctcca
cccgctgagcagctgctgagccaggccagggacttcatcaaccagtactacagctccatc
aagaggagcggctcccaggctcacgaggagcggcttcaggaggtggaggccgaggtggca
tccacgggcacctaccacctccgagagagtgagctggtgttcggggccaagcaggcctgg
cgcaaygcaccccgctgcgtgggccgcatccagtgggggaagctgcaggtgtttgatgcc
cgggactgcagctcagcacaggagatgttcacctacatctgcaaccacatcaagtaygcc
accaaccgcggcaaccttcgctcggccatcacagtgttcccgcagcgcgccccgggccgc
ggagacttccggatctggaacagccagctggtgcgctacgcaggctacagacagcaggat
ggctctgtgcgtggggacccagccaaygtggagatcacggagctctgcatccagcacggc
tggacccccggaaacggccgcttcgacgtgctgcccctgctgctccaggccccagacgag
gctccagagctctttgttctgccccccgagctggtccttgaagtgcccctggagcacccc
acactggagtggttcgcggccctgggcctgcgatggtatgccctcccggccgtgtccaac
atgctgctggaaatcgggggtctggagttctccgcggcccccttcagcggctggtacatg
agcacggagattggcacgcggaacctgtgtgaccctcaccgctacaatatcctggaggat
gtggccgtctgcatggacctcgacacgcggaccacctcgtccctgtggaaggacaaggcg
gccgtggagatcaacctggctgtgctgcacagctttcagctcgccaaggtgaccatcgtg
gaccaccacgccgccacggtgtccttcatgaagcacctggacaacgagcagaaggccagg
gggggctgccccgccgactgggcctggatcgtgccccccatctcaggcagcctcacgccc
gtcttccaccaggagatggtcaactacatcctgtcccctgccttccgctaccagccagac
ccctggaaagggagcgcgaccaagggcgccggcatcaccaggaagaagacctttaaggaa
gtggccaacgcggtgaagatctctgcctcactcatgggcaccctgatggccaagcgagtg
aaagcaaccatcctgtacgcctctgagaccggccgggcccagagctacgctcagcagctg
gggaggctcttccggaaggccttcgatccccgggtcctgtgcatggatgagtatgacgtg
gtgtccctggagcacgaggcactggtgctggtggtgaccagcacctttgggaatggcgat
cccccggagaatggagagagttttgcagctgccctgatggagatgtcggggccctacaac
agctccccacggccggaacagcacaagagttacaagatccgcttcaacagcgtctcctgc
tcagacccgctggtgtcctcctggcggcggaagagaaaggagtccagcaacacagacagc
gcgggggccctggggaccctcaggttctgtgtgttcggactgggctcccgggcgtacccc
cacttctgcgccttcgcgcgagcggtggacacccggctggaagagcttggaggggagcgg
ctgctgcagctgggccagggcgatgagctctgcggccaggaagaggccttccgtggttgg
gcaaaggcggcattccaggcctcctgtgagacsttctgcgttggggaggaggccaaggct
gctgcccaggacatcttcagccccaaacggagctggaaacgccagaggtaccggctgagc
gcccaggccgagggcctccagctgctgccaggcctgatccacgtgcacagacggaagatg
tttcaggccacagtcctctcggtggaaaatctgcaaagcagcaagtccacccgggccacc
atcctggtgcgcctggacactgcaggccaggaggggctgcagtaccagccgggggaccac
ataggcatctgcccgcccaaccggccgggcctggtggaggcgctgctgagccgcgtggag
gacccgccaccgcccaccgagtctgtggctgtggagcagctggagaaaggcagcccaggc
ggccctcctcccagctgggtgcgggacccacggctgcccccgtgcacgctgcgccaggct
ctcaccttcttcctggacatcacctccccacccagcccccggcttctccgactgctcagc
accctggccgaagaacccagcgagcagcaggagcttgagaccctcagtcaggacccccgg
cgctacgaggagtggaagtggttccgctgccccacgctgctggaggtgctggagcagttc
ccgtccgtggcgctgcccgccccgctgctcctcacccagctgcccctgctgcagccccgg
tactactctgtcagctcggcccccaacgcccaccccggagaggtccacctcacagtggcc
gtgctggcgtacaggacccaagatgggctgggccccctacactacggggtctgctccaca
tggctgagccagctcaagactggagaccccgtgccctgcttcatcaggggggctccctcc
ttccggctgccgcctgacccctacgtgccctgcatcctcgtgggccctggcactggcatc
gcccccttccggggattttggcaggagaggctgcatgacattgagagcaaagggctgcag
cccgcccccatgaccctggtgttcggctgccgctgctcccaactcgaccatctctaccgc
gacgaggtgcaggacgcccaggagcgcggggtgtttggccgcgtcctcaccgccttctcc
cgggaacctgacagccccaagacctacgtacaggacatcctgagaaccgagctggctgcc
gaggtgcaccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgtcact
atggcaaccagcgtcctgcagacggtgcagcgcatcttggcgacagagggcgacatggag
ctggacgaggcgggcgacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggac
attttcggcctcacgctgcgcacccaggaggtgacaagccgtatacgtacccagagcttt
tccctgcaggagcggcatctgcggggcgcggtgccctgggccttcgacccgcccggccca
gacacccccggcccctga

DBGET integrated database retrieval system