Bos indicus (zebu cattle): 109557810 Help Entry 109557810         CDS       T04792                                  Gene name RHEB Definition (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism biu  Bos indicus (zebu cattle) Pathway biu04072   Phospholipase D signaling pathway biu04140   Autophagy - animal biu04150   mTOR signaling pathway biu04151   PI3K-Akt signaling pathway biu04152   AMPK signaling pathway biu04211   Longevity regulating pathway biu04218   Cellular senescence biu04714   Thermogenesis biu04910   Insulin signaling pathway biu04919   Thyroid hormone signaling pathway biu05163   Human cytomegalovirus infection biu05165   Human papillomavirus infection biu05168   Herpes simplex virus 1 infection biu05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     109557810 (RHEB)    04151 PI3K-Akt signaling pathway     109557810 (RHEB)    04152 AMPK signaling pathway     109557810 (RHEB)    04150 mTOR signaling pathway     109557810 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109557810 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     109557810 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     109557810 (RHEB)    04919 Thyroid hormone signaling pathway     109557810 (RHEB)   09149 Aging    04211 Longevity regulating pathway     109557810 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     109557810 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     109557810 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     109557810 (RHEB)    05163 Human cytomegalovirus infection     109557810 (RHEB)    05165 Human papillomavirus infection     109557810 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:biu04031]     109557810 (RHEB) GTP-binding proteins [BR:biu04031]  Small (monomeric) G-proteins   Ras Family    Rheb     109557810 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB Motif Other DBs NCBI-GeneID:  109557810 NCBI-ProteinID:  XP_019814913 UniProt:  A0A6P5B979 LinkDB All DBs Position 4 AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcgttgacgattcagtttgttgaaggccaatttgttgactcctacgatccaaccatagaa aatactttcacaaaattgatcacagtaaatggacaggagtatcatcttcaacttgtggac acagctgggcaggatgaatattccatctttcctcagacatactccatagatattaatggc tatattcttgtgtattctgttacatcaatcaaaagctttgaagtgatcaaagttatccat ggtaaattgttggatatggtggggaaagtacagatacctattatgttggttgggaataag aaagacctacatatggaaagggtgatcagttatgaagaagggaaagcgttagcagagtct tggaacgcagcgtttttggaatcatctgctaaagaaaatcagactgctgttgatgttttt agaaggataattttggaggcagaaaaaatcgatggggccgcttcacaaggaaagtcttcc tgctcggtgatgtga

DBGET integrated database retrieval system