KEGG   Bos indicus (zebu cattle): 109557810
Entry
109557810         CDS       T04792                                 

Gene name
RHEB
Definition
(RefSeq) GTP-binding protein Rheb
  KO
K07208  Ras homolog enriched in brain
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04072  Phospholipase D signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04218  Cellular senescence
biu04714  Thermogenesis
biu04910  Insulin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05168  Herpes simplex virus 1 infection
biu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    109557810 (RHEB)
   04151 PI3K-Akt signaling pathway
    109557810 (RHEB)
   04152 AMPK signaling pathway
    109557810 (RHEB)
   04150 mTOR signaling pathway
    109557810 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109557810 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    109557810 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109557810 (RHEB)
   04919 Thyroid hormone signaling pathway
    109557810 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    109557810 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    109557810 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    109557810 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109557810 (RHEB)
   05163 Human cytomegalovirus infection
    109557810 (RHEB)
   05165 Human papillomavirus infection
    109557810 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:biu04031]
    109557810 (RHEB)
GTP-binding proteins [BR:biu04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    109557810 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB
Other DBs
NCBI-GeneID: 109557810
NCBI-ProteinID: XP_019814913
UniProt: A0A6P5B979
LinkDB
Position
4
AA seq 184 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS
CSVM
NT seq 555 nt   +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcgttgacgattcagtttgttgaaggccaatttgttgactcctacgatccaaccatagaa
aatactttcacaaaattgatcacagtaaatggacaggagtatcatcttcaacttgtggac
acagctgggcaggatgaatattccatctttcctcagacatactccatagatattaatggc
tatattcttgtgtattctgttacatcaatcaaaagctttgaagtgatcaaagttatccat
ggtaaattgttggatatggtggggaaagtacagatacctattatgttggttgggaataag
aaagacctacatatggaaagggtgatcagttatgaagaagggaaagcgttagcagagtct
tggaacgcagcgtttttggaatcatctgctaaagaaaatcagactgctgttgatgttttt
agaaggataattttggaggcagaaaaaatcgatggggccgcttcacaaggaaagtcttcc
tgctcggtgatgtga

DBGET integrated database retrieval system